A. Abdi, S. Eschenlauer, L. Reininger, and C. Doerig, SAM DomainDependent Activity of PfTKL3, an Essential Tyrosine Kinase-like Kinase of the Human Malaria Parasite Plasmodium Falciparum, Cellular and Molecular Life Sciences, vol.67, pp.3355-69, 2010.

A. I. Abdi, T. G. Carvalho, J. M. Wilkes, and C. Doerig, A Secreted Plasmodium Falciparum Kinase Reveals a Signature Motif for Classification of Tyrosine Kinase-like Kinases, Microbiology (United Kingdom), vol.159, pp.2533-2580, 2013.

,

. Absalon, J. A. Sabrina, J. D. Robbins, and . Dvorin, An Essential Malaria Protein Defines the Architecture of Blood-Stage and Transmission-Stage Parasites, Nature Communications, vol.7, p.11449, 2016.

J. H. Adams and I. Mueller, The Biology of Plasmodium Vivax, Cold Spring Harbor Perspectives in Medicine, vol.7, issue.9, pp.1-12, 2017.

S. M. Adl, A. G. Simpson, C. E. Lane, J. Luke?, D. Bass et al., The Revised Classification of Eukaryotes, J Eukaryot Microbiol, vol.59, issue.5, pp.429-93, 2012.

M. Aikawa, L. H. Miller, J. Johnson, and J. Rabbege, Erythrocyte Entry by Malarial Parasites, Journal of Cell Biology, vol.77, issue.1, pp.72-82, 1978.

A. , A. D. , P. G. Righetti, and L. Zolla, The Red Blood Cell Proteome and Interactome : An Update, Journal of Proteome Research, vol.9, pp.144-63, 2010.

D. L. Alexander, J. F. Shirin-arastu-kapur, J. C. Dubremetz, and . Boothroyd, Plasmodium Falciparum AMA1 Binds a Rhoptry Neck Protein Homologous to TgRON4, a Component of the Moving Junction in Toxoplasma Gondii, Eukaryotic Cell, vol.5, issue.7, pp.1169-73, 2006.

D. L. Alexander, J. Mital, G. E. Ward, P. Bradley, and J. C. Boothroyd, Identification of the Moving Junction Complex of Toxoplasma Gondii: A Collaboration between Distinct Secretory Organelles, PLoS Pathogens, vol.1, issue.2, pp.137-186, 2005.

,

A. S. Aly and K. Matuschewski, A Malarial Cysteine Protease Is Necessary for Plasmodium Sporozoite Egress from Oocysts, The Journal of Experimental Medicine, vol.202, issue.2, pp.225-255, 2005.

A. Amir, F. Wen-cheong, J. R. Silva, and Y. L. Lau, Diagnostic Tools in Childhood Malaria, Parasites and Vectors, vol.11, issue.1, pp.1-12, 2018.

T. Ammosova, M. Platonov, R. K. Venkat, Y. Yedavalli, . Obukhov et al., Small Molecules Targeted to a NonCatalytic 'RVxF' Binding Site of Protein Phosphatase-1 Inhibit HIV-1, PLoS ONE, vol.7, issue.6, 2012.

,

N. Anamika, A. Srinivasan, and . Krupa, A Genomic Perspective of Protein Kinases in Plasmadium Falciparum, Proteins: Structure, Function and Genetics, vol.58, issue.1, pp.180-89, 2005.

,

G. Anderluh, J. Punger?ar, B. ?trukelj, P. Ma?ek, and F. Guben?ek, Cloning, Sequencing, and Expression of Equinatoxin II, Biochemical and Biophysical Research Communications, vol.220, issue.2, pp.437-479, 1996.

H. Antony, S. Ashmi, and . Parija, Antimalarial Drug Resistance: An Overview, Tropical Parasitology, vol.6, issue.1, p.30, 2016.

T. Araki, L. H. Vu, N. Sasaki, T. Kawata, L. Eichinger et al., Two Dictyostelium Tyrosine Kinase-like Kinases Function in Parallel, Stress-Induced STAT Activation Pathways, Molecular Biology of the Cell, vol.25, pp.3222-3255, 1920.

N. Arisue, S. Kawai, M. Hirai, M. Q. Nirianne, M. Palacpac et al., Clues to Evolution of the SERA Multigene Family in 18 Plasmodium Species, PLoS ONE, vol.6, issue.3, p.17775, 2011.

S. C. Atkinson, J. S. Armistead, D. K. Mathias, M. M. Sandeu, D. Tao et al., Structural Analysis of Anopheles Midgut Aminopeptidase N Reveals a Novel Malaria Transmission-Blocking Vaccine B-Cell Epitope, Nat Struct Mol Biol, vol.22, issue.7, pp.532-571, 2015.

C. Aurrecoechea, J. Brestelli, B. P. Brunk, J. Dommer, S. Fischer et al., PlasmoDB: A Functional Genomic Database for Malaria Parasites, Nucleic Acids Research, vol.37, issue.1, pp.539-582, 2009.

T. Aviv, Z. Lin, S. Lau, L. M. Rendl, F. Sicheri et al., The RNABinding SAM Domain of Smaug Defines a New Family of Post-Transcriptional Regulators, Nature Structural Biology, vol.10, issue.8, pp.614-635, 2003.

J. N. Balaich, K. Derrick, B. Mathias, B. T. Torto, D. Jackson et al., The Nonartemisinin Sesquiterpene Lactones Parthenin and Parthenolide Block Plasmodium Falciparum Sexual Stage Transmission, Antimicrobial Agents and Chemotherapy, vol.60, issue.4, pp.2108-2125, 2016.

S. Balaji, M. M. Babu, M. Lakshminarayan, L. Iyer, and . Aravind, Discovery of the Principal Specific Transcription Factors of Apicomplexa and Their Implication for the Evolution of the AP2-Integrase DNA Binding Domains, Nucleic Acids Research, vol.33, issue.13, pp.3994-4006, 2005.

,

L. Bannister and G. Mitchell, The Ins, Outs and Roundabouts of Malaria, Trends in Parasitology, vol.19, issue.5, pp.86-88, 2003.

B. E. Barber, J. Matthew, T. Grigg, K. A. William, M. J. Piera et al., Effects of Aging on Parasite Biomass, Inflammation, Endothelial Activation, Microvascular Dysfunction and Disease Severity in Plasmodium Knowlesi and Plasmodium Falciparum Malaria, Journal of Infectious Diseases, vol.215, issue.12, pp.1908-1925, 2017.

B. E. Barber, S. Giri, M. J. Rajahram, T. Grigg, N. M. William et al., World Malaria Report: Time to Acknowledge Plasmodium Knowlesi Malaria, Malaria Journal, vol.16, 2017.

F. N. Barrera, A. José, . Poveda, M. José, J. L. González-ros et al., Binding of the CTerminal Sterile ? Motif (SAM) Domain of Human P73 to Lipid Membranes, Journal of Biological Chemistry, vol.278, issue.47, pp.46878-85, 2003.

J. Baum, A. T. Papenfuss, G. R. Mair, C. J. Janse, D. Vlachou et al.,

F. Cowman, B. S. Crabb, and T. F. Koning-ward, Molecular Genetics and Comparative Genomics Reveal RNAi Is Not Functional in Malaria Parasites, Nucleic Acids Research, vol.37, issue.11, pp.3788-98, 2009.

D. P. Bechtsi and A. P. Waters, Genomics and Epigenetics of Sexual Commitment in Plasmodium, International Journal for Parasitology, vol.47, issue.7, pp.425-459, 2017.

,

M. S. Behnke, A. Khan, E. J. Lauron, J. R. Jimah, Q. Wang et al., Rhoptry Proteins ROP5 and ROP18 Are Major Murine Virulence Factors in Genetically Divergent South American Strains of Toxoplasma Gondii, PLoS Genetics, vol.11, issue.8, pp.1-22, 2015.

G. Benelli and J. C. Beier, Current Vector Control Challenges in the Fight against Malaria, Acta Tropica, vol.174, pp.91-96, 2017.

. Bennink, M. J. Sandra, G. Kiesow, and . Pradel, The Development of Malaria Parasites in the Mosquito Midgut, Cellular Microbiology, vol.18, issue.7, pp.905-923, 2016.

M. Bernabeu, F. J. Lopez, M. Ferrer, L. Martin-jaular, A. Razaname et al., Functional Analysis of Plasmodium Vivax VIR Proteins Reveals Different Subcellular Localizations and Cytoadherence to the ICAM-1 Endothelial Receptor, Cellular Microbiology, vol.14, issue.3, pp.386-400, 2012.

S. Besteiro, J. F. Dubremetz, and M. Lebrun, The Moving Junction of Apicomplexan Parasites: A Key Structure for Invasion, Cellular Microbiology, vol.13, issue.6, pp.797-805, 2011.

M. K. Bhattacharyya, Z. Hong, D. Kongkasuriyachai, and N. Kumar, Plasmodium Falciparum Protein Phosphatase Type 1 Functionally Complements a Glc7 Mutant in Saccharomyces Cerevisiae, International Journal for Parasitology, vol.32, issue.6, pp.739-786, 2002.

, , pp.7-10

P. L. Birget, A. Megan, S. E. Greischar, N. Reece, and . Mideo, Altered Life History Strategies Protect Malaria Parasites against Drugs, Evolutionary Applications, vol.11, issue.4, pp.442-55, 2018.

J. Birnbaum, S. Flemming, N. Reichard, A. B. Soares, P. Mesén-ramírez et al., A Genetic System to Study Plasmodium Falciparum Protein Function, Nature Methods, vol.14, issue.4, pp.450-56, 2017.

E. Bischoff and C. Vaquero, In Silico and Biological Survey of TranscriptionAssociated Proteins Implicated in the Transcriptional Machinery during the Erythrocytic Development of Plasmodium Falciparum, BMC Genomics, vol.11, p.34, 2010.
URL : https://hal.archives-ouvertes.fr/pasteur-00663529

T. Blisnick, L. Vincensini, G. Fall, and C. Braun-breton, Protein Phosphatase 1, a Plasmodium Falciparum Essential Enzyme, Is Exported to the Host Cell and Implicated in the Release of Infectious Merozoites, Cellular Microbiology, vol.8, issue.4, pp.591-601, 2006.

J. G. Boer, A. De, S. J. Robinson, . Powers, L. G. Saskia et al., Odours of Plasmodium Falciparum-Infected Participants Influence Mosquito-Host Interactions, Scientific Reports, vol.7, issue.1, pp.1-9, 2017.

S. E. Bondos and A. Bicknell, Detection and Prevention of Protein Aggregation before, during, and after Purification, Analytical Biochemistry, vol.316, issue.2, pp.59-68, 2003.

D. Bossemeyer, The Glycine-Rich Sequence of Protein Kinases: A Multifunctional Element, Trends in Biochemical Sciences, vol.19, issue.5, pp.90022-90023, 1994.

A. Bouchut, D. Rotili, C. Pierrot, S. Valente, S. Lafitte et al., Identification of Novel Quinazoline Derivatives as Potent Antiplasmodial Agents, European Journal of Medicinal Chemistry, vol.161, pp.277-91, 2019.

,

J. Boudeau, D. Miranda-saavedra, G. J. Barton, and D. R. Alessi, Emerging Roles of Pseudokinases, Trends in Cell Biology, vol.16, issue.9, pp.443-52, 2006.

D. L. Brautigan, Protein Ser/ Thr Phosphatases -The Ugly Ducklings of Cell Signalling, FEBS Journal, vol.280, issue.2, pp.324-369, 2013.

A. R. Brock, J. V. Ross, S. Parikh, and A. Esterman, The Role of Antimalarial Quality in the Emergence and Transmission of Resistance, Medical Hypotheses, vol.111, pp.49-54, 2017.

K. M. Brown and L. D. Sibley, Essential CGMP Signaling in Toxoplasma Is Initiated by a Hybrid P-Type ATPase-Guanylate Cyclase, Cell Host & Microbe, vol.24, issue.6, pp.804-816, 2018.

E. M. Bunnik, G. Batugedara, A. Saraf, J. Prudhomme, L. Florens et al., The MRNA-Bound Proteome of the Human Malaria Parasite Plasmodium Falciparum, Genome Biology, vol.17, issue.1, pp.1-18, 2016.

F. Burki, K. Shalchian-tabrizi, M. Minge, Å. Skjaeveland, I. Sergey et al., Phylogenomics Reshuffles the Eukaryotic Supergroups, PLoS ONE, vol.2, issue.8, pp.1-6, 2007.

F. Burki, K. Shalchian-tabrizi, and J. Pawlowski, Phylogenomics Reveals a New 'megagroup' Including Most Photosynthetic Eukaryotes, Biology Letters, vol.4, issue.4, pp.366-69, 2008.

J. M. Burns, K. Eric, C. C. Adeeku, P. D. Belk, and . Dunn, An Unusual TryptophanRich Domain Characterizes Two Secreted Antigens of Plasmodium Yoelii-Infected Erythrocytes, Molecular and Biochemical Parasitology, vol.110, issue.1, pp.252-260, 2000.

E. Bushell, A. R. Gomes, T. Sanderson, B. Anar, G. Girling et al., Functional Profiling of a Plasmodium Genome Reveals an Abundance of Essential Genes, Cell, vol.170, issue.2, pp.260-272, 2017.

A. O. Busula, O. Niels, T. Verhulst, W. Bousema, J. G. Takken et al., Mechanisms of Plasmodium-Enhanced Attraction of Mosquito Vectors, Trends in Parasitology, vol.33, issue.12, pp.961-73, 2017.

G. A. Butcher and G. H. Mitchell, The Role of Plasmodium Knowlesi in the History of Malaria Research, Parasitology, vol.145, issue.1, pp.6-17, 2016.

G. Camarda, L. Bertuccini, . Saurabh-kumar, A. M. Singh, A. Salzano et al., Regulated Oligomerisation and Molecular Interactions of the Early Gametocyte Protein Pfg27 in Plasmodium Falciparum Sexual Differentiation, International Journal for Parasitology, vol.40, issue.6, pp.663-73, 2010.

,

D. Camus and C. Chidiac, Bulletin Epidémiologique Hebdomadaire Hors-série, 2018.

R. A. Carreno, J. C. Kissinger, T. F. Mccutchan, and J. R. Barta, Phylogenetic Analysis of Haemosporinid Parasites (Apicomplexa: Haemosporina) and Their Coevolution with Vectors and Intermediate Hosts, Archiv Fur Protistenkunde, vol.148, issue.3, p.80005, 1997.

T. Carvalho, B. Gil, S. Morahan, P. John-von-freyend, G. Boeuf et al., The Ins and Outs of Phosphosignalling in Plasmodium: Parasite Regulation and Host Cell Manipulation, Molecular and Biochemical Parasitology, vol.208, issue.1, pp.2-15, 2016.

T. Cavalier-smith, Alveolates, GBIF, 1991.

. Cdc, Investing in Malaria in Pregnancy in Sub-Saharan Africa, 2017.

H. Ceulemans and M. Bollen, Functional Diversity of Protein Phosphatase-1, a Cellular Economizer and Reset Button, Physiological Reviews, vol.84, issue.1, pp.1-39, 2004.

, A Tighter RVxF Motif Makes a Finer Sift, Chemistry and Biology, vol.13, issue.1, pp.6-8, 2006.

H. Ceulemans, W. Stalmans, and M. Bollen, Regulator-Driven Functional Diversification of Protein Phosphatase-1 in Eukaryotic Evolution, BioEssays, vol.24, issue.4, pp.371-81, 2002.

C. I. Chandler and U. Beisel, The Anthropology of Malaria: Locating the Social, Medical Anthropology: Cross Cultural Studies in Health and Illness, vol.36, issue.5, pp.411-432, 2017.

,

L. Chao, H. , and J. Avruch, Cryo-EM Insight into the Structure of MTOR Complex 1 and Its Interactions with Rheb and Substrates, F1000Research, vol.8, issue.14, pp.1-10, 2019.

,

A. J. Charron and L. D. Sibley, Molecular Partitioning during Host Cell Penetration by Toxoplasma Gondii, Traffic, vol.5, issue.11, pp.855-67, 2004.

J. Chatterjee, M. Beullens, R. Sukackaite, J. Qian, B. Lesage et al., Development of a Peptide That Selectively Activates Protein Phosphatase-1 in Living Cells, Angewandte Chemie -International Edition, vol.51, issue.40, pp.10054-59, 2012.

M. J. Chen, E. Jack, G. Dixon, and . Manning, Genomics and Evolution of Protein Phosphatases, Science Signaling, vol.10, issue.474, p.1796, 2017.

. Chêne, S. S. Arnaud, L. Vembar, J. J. Rivière, A. Lopez-rubio et al., PfAlbas Constitute a New Eukaryotic DNA/RNA-Binding Protein Family in Malaria Parasites, Nucleic Acids Research, vol.40, issue.7, pp.3066-77, 2012.

S. A. Cobbold, J. M. Santos, A. Ochoa, D. H. Perlman, and M. Llinas, Proteome-Wide Analysis Reveals Widespread Lysine Acetylation of Major Protein Complexes in 200, 2016.

. The-malaria-parasite, Scientific Reports, vol.6, pp.1-14, 2015.

N. R. Cohen, A. Michael, J. J. Lobritz, and . Collins, Microbial Persistence and the Road to Drug Resistance, Cell Host and Microbe, vol.13, issue.6, pp.632-674, 2013.

C. R. Collins, S. Das, E. H. Wong, N. Andenmatten, R. Stallmach et al., Robust Inducible Cre Recombinase Activity in the Human Malaria Parasite Plasmodium Falciparum Enables Efficient Gene Deletion within a Single Asexual Erythrocytic Growth Cycle, Molecular Microbiology, vol.88, issue.4, pp.687-701, 2013.

C. R. Collins, F. Hackett, J. Atid, M. S. , Y. Tan et al., The Plasmodium Falciparum Pseudoprotease SERA5 Regulates the Kinetics and Efficiency of Malaria Parasite Egress from Host Erythrocytes, PLoS Pathogens, vol.13, 2017.

M. O. Collins, C. James, M. Wright, J. C. Jones, J. S. Rayner et al., Confident and Sensitive Phosphoproteomics Using Combinations of Collision Induced Dissociation and Electron Transfer Dissociation, Journal of Proteomics, vol.103, pp.1-14, 2014.

,

W. E. Collins and G. M. Jeffery, Plasmodium Malariae: Parasite and Disease, Clinical Microbiology Reviews, vol.20, issue.4, pp.579-92, 2007.

M. Colombo, G. Raposo, and C. Théry, Biogenesis, Secretion, and Intercellular Interactions of Exosomes and Other Extracellular Vesicles, Annual Review of Cell and Developmental Biology, vol.30, issue.1, pp.255-89, 2014.

A. Cortés and K. W. Deitsch, Malaria Epigenetics, Cold Spring Harbor Perspectives in Medicine, vol.7, issue.7, pp.1-23, 2017.

R. M. Coulson, N. Hall, and C. A. Ouzounis, Comparative Genomics of Transcriptional Control in the Human Malaria Parasite Plasmodium Falciparum, Genome Research, vol.14, issue.8, pp.1548-54, 2004.

M. Cova, J. A. Rodrigues, T. K. Smith, and L. Izquierdo, Sugar Activation and Glycosylation in Plasmodium, Malaria Journal, vol.14, issue.1, pp.1-10, 2015.

A. F. Cowman, J. Healer, D. Marapana, and K. Marsh, Malaria: Biology and Disease, Cell, vol.167, issue.3, pp.610-634, 2016.

F. E. Cox, History of Human Parasitology, Clinical Microbiology Reviews, vol.15, issue.4, pp.595-612, 2002.

F. E. Cox, History of the Discovery of the Malaria Parasites and Their Vectors, Parasites & Vectors, vol.3, issue.5, pp.1-9, 2010.

P. D. Crompton, J. Moebius, M. Waisberg, S. Lindsey, . Garver et al., Malaria Immunity in Man and Mosquito: Insights into Unsolved Mysteries of a Deadly Infectious Disease, Annu Rev Immunol, vol.32, pp.157-87, 2014.

,

C. B. Cunha and B. A. Cunha, Brief History of the Clinical Diagnosis of Malaria: From Hippocrates to Osler, Journal of Vector Borne Diseases, vol.45, issue.3, pp.194-99, 2008.

M. Cyrklaff, F. Frischknecht, and M. Kudryashev, Functional Insights into Pathogen Biology from 3D Electron Microscopy, FEMS Microbiology Reviews, vol.41, issue.6, pp.828-53, 2017.

N. Daddy, . Bati, P. G. Luc-malemo-kalisya, R. L. Bagire, M. J. Watt et al., Artemisia Annua Dried Leaf Tablets Treated Malaria Resistant to ACT and i.v. Artesunate: Case Reports, Phytomedicine, vol.32, pp.37-40, 2017.

,

W. Daher, E. Browaeys, C. Pierrot, H. Jouin, D. Dive et al., Regulation of Protein Phosphatase Type 1 and Cell Cycle Progression by PfLRR1, a Novel Leucine-Rich Repeat Protein of the Human Malaria Parasite Plasmodium Falciparum, Molecular Microbiology, vol.60, issue.3, pp.578-90, 2006.
URL : https://hal.archives-ouvertes.fr/hal-00086327

U. Dalrymple, R. Arambepola, P. W. Gething, and E. Cameron, How Long Do Rapid Diagnostic Tests Remain Positive after Anti-Malarial Treatment?, Malaria Journal, vol.17, issue.1, pp.1-13, 2018.

A. J. Davies and M. R. Johnston, The Biology of Some Intraerythrocytic Parasites of Fishes, Amphibia and Reptiles, Advances in Parasitology, vol.45, issue.5, pp.45003-45010, 2000.

H. M. Davies, D. Stephanie, E. J. Nofal, A. R. Mclaughlin, and . Osborne, Repetitive Sequences in Malaria Parasite Proteins, FEMS Microbiology Reviews, vol.41, issue.6, pp.923-963, 2017.

K. W. Deitsch, Parasite Pathogenesis: The Dynamics of Chronic Malaria, Nature Microbiology, vol.2, pp.1-2, 2017.

E. R. Derbyshire, A. D. Vanessa-zuzarte-luís, N. Magalhães, P. C. Kato, J. Sanschagrin et al., Chemical Interrogation of Malarial Host and Parasite Kinomes, ChemBioChem, vol.15, issue.13, pp.1920-1950, 2014.

S. A. Desai, Why Do Malaria Parasites Increase Host Erythrocyte Permeability?, Trends in Parasitology, vol.30, issue.3, pp.151-59, 2014.

Q. Deveuve, K. Lesage, T. Mouveaux, and M. Gissot, The Toxoplasma Gondii Inhibitor-2 Regulates Protein Phosphatase 1 Activity through Multiple Motifs, Parasitology Research, vol.116, issue.9, pp.2417-2443, 2017.
URL : https://hal.archives-ouvertes.fr/hal-02106427

J. M. Devos, J. Stephen, C. E. Tomanicek, N. G. Jones, T. C. Nossal et al., Crystal Structure of Bacteriophage T4 5? Nuclease in Complex with a Branched DNA Reveals How Flap Endonuclease-1 Family Nucleases Bind Their Substrates, Journal of Biological Chemistry, vol.282, issue.43, pp.31713-31737, 2007.

L. Diederich, T. Suvorava, R. Sansone, T. C. Stevenson-keller, F. Barbarino et al., On the Effects of Reactive Oxygen Species and Nitric Oxide on Red Blood Cell Deformability, Frontiers in Physiology, vol.9, p.332, 2018.

C. Dimala, . Akem, B. M. Belmond-tse-kika, H. Kadia, and . Blencowe, Current Challenges and Proposed Solutions to the Effective Implementation of the RTS, 2018.

, Malaria Vaccine Program in Sub-Saharan Africa: A Systematic Review, Plos One, vol.13, issue.12

A. R. Dluzewski and C. R. Garcia, Inhibition of Invasion and Intraerythrocytic Development of Plasmodium Falciparum by Kinase Inhibitors, Experientia, vol.52, issue.6, pp.621-644, 1996.

,

C. Doerig, O. Billker, D. Pratt, and J. Endicott, Protein Kinases as Targets for Antimalarial Intervention: Kinomics, Structure-Based Design, Transmission-Blockade, and Targeting Host Cell Enzymes, Biochimica et Biophysica Acta -Proteins and Proteomics, vol.1754, issue.1-2, pp.132-50, 2005.

. Doerig, J. C. Christian, A. Rayner, A. B. Scherf, and . Tobin, Post-Translational Protein Modifications in Malaria Parasites, Nature Reviews Microbiology, vol.13, issue.3, pp.160-72, 2015.

G. G. Dooren, B. Van, and . Striepen, The Algal Past and Parasite Present of the Apicoplast, Annual Review of Microbiology, vol.67, issue.1, pp.271-89, 2013.

S. J. Draper, K. Brandon, C. R. Sack, C. M. King, J. C. Nielsen et al., Malaria Vaccines: Recent Advances and New Horizons, Cell Host and Microbe, vol.24, issue.1, pp.43-56, 2018.

L. L. Drewry and L. D. Sibley, Toxoplasma Actin Is Required for Efficient Host Cell Invasion, MBio, vol.6, issue.3, p.28, 2015.

K. Dundas, M. J. Shears, P. Sinnis, and G. J. Wright, Important Extracellular Interactions between Plasmodium Sporozoites and Host Cells Required for Infection, Trends in Parasitology, vol.xx, pp.1-11, 2018.

M. T. Duraisingh and K. M. Skillman, Epigenetic Variation and Regulation in Malaria Parasites, Annual Review of Microbiology, vol.72, issue.1, 2018.

,

E. S. Egan, Beyond Hemoglobin: Screening for Malaria Host Factors, Trends in Genetics, vol.34, issue.2, pp.133-174, 2018.

M. Egloff, D. F. Johnson, G. Moorhead, T. Patricia, P. Cohen et al., Structural Basis for the Recognition of Regulatory Subunits by the Catalytic Subunit of Protein Phosphatase 1 Specific Protein Phosphatases of Eukaryotic Cells (Stralfors Diverse Cellular Functions Including Glycogen Metabolism, The EMBO Journal Cohen, vol.16, issue.8, pp.1876-87, 1997.

R. D. Etheridge, K. Aditi-alaganan, . Tang, J. Hua, B. E. Lou et al., The Toxoplasma Pseudokinase ROP5 Forms Complexes with ROP18 and ROP17, 2014.

, Kinases That Synergize to Control Acute Virulence in Mice, Cell Host and Microbe, vol.15, issue.5, pp.537-50

P. A. Eyers and J. M. Murphy, Dawn of the Dead: Protein Pseudokinases Signal New Adventures in Cell Biology, Biochemical Society Transactions, vol.41, issue.4, pp.969-74, 2013.

,

D. J. Ferguson, N. Sahoo, R. A. Pinches, J. M. Bumstead, F. M. Tomley et al., MORN1 Has a Conserved Role in Asexual and Sexual Development across the Apicomplexa, Eukaryotic Cell, vol.7, issue.4, pp.698-711, 2008.

D. A. Fidock and T. E. Wellems, Transformation with Human Dihydrofolate Reductase Renders Malaria Parasites Insensitive to WR99210 but Does Not Affect the Intrinsic Activity of Proguanil, Proceedings of the National Academy of Sciences, vol.94, issue.20, pp.10931-10967, 1997.

L. Fraisse, Artefenomel (OZ439) plus Ferroquine, 2017.

K. Frénal, C. L. Tay, C. Mueller, E. S. Bushell, Y. Jia et al., Global Analysis of Apicomplexan Protein S-Acyl Transferases Reveals an Enzyme Essential for Invasion, Traffic, vol.14, issue.8, pp.895-911, 2013.

A. Fréville, K. Cailliau-maggio, C. Pierrot, G. Tellier, H. Kalamou et al., Plasmodium Falciparum Encodes a Conserved Active Inhibitor-2 for Protein Phosphatase Type 1: Perspectives for Novel Anti-Plasmodial Therapy, BMC Biology, vol.11, 2013.

A. Fréville, I. Landrieu, M. García-gimeno, J. Vicogne, M. Montbarbon et al., Plasmodium Falciparum Inhibitor-3 Homolog Increases Protein Phosphatase Type 1 Activity and Is Essential for Parasitic Survival, Journal of Biological Chemistry, vol.287, issue.2, pp.1306-1327, 2012.

A. Fréville, G. Tellier, A. Vandomme, C. Pierrot, J. Vicogne et al., Identification of a Plasmodium Falciparum Inhibitor-2 Motif Involved in the Binding and Regulation Activity of Protein Phosphatase Type 1, FEBS Journal, vol.281, pp.4519-4553, 2014.

Z. Füssy, P. Masa?ová, J. Kru?inská, H. J. Esson, and M. Oborník, Budding of the Alveolate Alga Vitrella Brassicaformis Resembles Sexual and Asexual Processes in Apicomplexan Parasites, Protist, vol.168, issue.1, pp.80-91, 2017.

R. Galizi, F. Spano, M. A. Giubilei, B. Capuccini, A. Magini et al., Evidence of TRNA Cleavage in Apicomplexan Parasites: Half-TRNAs as New Potential Regulatory Molecules of Toxoplasma Gondii and Plasmodium Berghei, vol.188, pp.99-108, 2013.

,

J. Gallego-delgado and A. Rodriguez, Rupture and Release: A Role for Soluble Erythrocyte Content in the Pathology of Cerebral Malaria, p.33, 2017.

J. Gantier, Paludisme et Maîtrise Des Populations Anophéliennes" 110, 1998.

H. Gao, Z. Yang, X. Wang, P. Qian, R. Hong et al., ISP1-Anchored Polarization of GC?/CDC50A Complex Initiates Malaria Ookinete Gliding Motility, Current Biology, vol.28, issue.17, pp.2763-2776, 2018.

C. H. Garcia, D. Depoix, M. L. Rayner, . Queiroz, M. F. Jaques et al., Dynamic Molecular Events Associated to Plasmodium Berghei Gametogenesis through Proteomic Approach, Journal of Proteomics, vol.180, pp.88-98, 2017.
URL : https://hal.archives-ouvertes.fr/hal-02126894

,

M. J. Gardner, N. Hall, E. Fung, O. White, M. Berriman et al., Genome Sequence of the Human Malaria Parasite Plasmodium Falciparum, Nature, vol.419, issue.6906, pp.498-511, 2002.

R. T. Gazzinelli, P. Kalantari, K. A. Fitzgerald, and D. T. Golenbock, Innate Sensing of Malaria Parasites, Nature Reviews Immunology, vol.14, issue.11, pp.744-57, 2014.

,

M. Ghorbal, M. Gorman, C. R. Macpherson, R. M. Martins, A. Scherf et al., Genome Editing in the Human Malaria Parasite Plasmodium Falciparum Using the CRISPR-Cas9 System, Nature Biotechnology, vol.32, issue.8, pp.819-840, 2014.

S. Ghosh, K. Kennedy, P. Sanders, K. Matthews, S. A. Ralph et al., The Plasmodium Rhoptry Associated Protein Complex Is Important for Parasitophorous Vacuole Membrane Structure and Intraerythrocytic Parasite Growth, Cellular Microbiology, vol.19, issue.8, p.12733, 2017.

P. R. Gilson, T. Nebl, D. Vukcevic, R. L. Moritz, T. Sargeant et al., Identification and Stoichiometry of Glycosylphosphatidylinositol-Anchored Membrane Proteins of the Human Malaria Parasite Plasmodium Falciparum, Molecular & Cellular Proteomics, vol.5, issue.7, pp.1286-99, 2006.

,

J. E. Gisselberg, L. Zhang, J. E. Elias, and E. Yeh, The Prenylated Proteome of Plasmodium Falciparum Reveals Pathogen-Specific Prenylation Activity and Drug Mechanism-ofAction, Molecular & Cellular Proteomics, vol.16, pp.54-64, 2017.

,

B. Glover, O. Akinbo, M. Savadogo, S. Timpo, G. Lemgo et al., Strengthening Regulatory Capacity for Gene Drives in Africa: Leveraging NEPAD's Experience in Establishing Regulatory Systems for Medicines and GM Crops in Africa, BMC Proceedings, vol.12, issue.8, 2018.

A. N. Godet, V. Julien-guergnon, A. Maire, A. Croset, and . Garcia, The Combinatorial PP1-Binding Consensus Motif (R/K)x(0,1)v/IxFxx(R/K)x(R/K) Is a New Apoptotic Signature, PLoS ONE, vol.5, issue.4, pp.1-8, 2010.

. Groger, H. S. Mirjam, L. Fischer, A. Veletzky, M. Lalremruata et al., A Systematic Review of the Clinical Presentation, Treatment and Relapse Characteristics of Human Plasmodium Ovale Malaria, Malaria Journal, vol.16, issue.1, pp.1-16, 2017.

M. Gubbels, S. Vaishnava, and N. Boot, A MORN-Repeat Protein Is a Dynamic Component of the Toxoplasma Gondii Cell Division Apparatus, Journal of Cell Science, vol.119, issue.11, pp.2236-2281, 2006.

J. Guergnon, F. Dessauge, V. Dominguez, J. Viallet, S. Bonnefoy et al., Use of Penetrating Peptides Interacting with PP1/PP2A Proteins As a General Approach for a Drug Phosphatase Technology, Molecular Pharmacology, vol.69, issue.4, pp.1115-1139, 2006.
URL : https://hal.archives-ouvertes.fr/pasteur-00189544

A. Guérin, R. M. Corrales, M. L. Parker, H. Mauld, D. Lamarque et al., Efficient Invasion by Toxoplasma Depends on the Subversion of Host Protein Networks, Nature Microbiology, vol.2, issue.10, pp.1358-66, 2017.

A. M. Guggisberg, J. Park, R. L. Edwards, M. L. Kelly, D. M. Hodge et al., A Sugar Phosphatase Regulates the Methylerythritol Phosphate (MEP) Pathway in Malaria Parasites, Nature Communications, vol.5, pp.1-10, 2014.

A. P. Gupta and Z. Bozdech, Epigenetic Landscapes Underlining Global Patterns of Gene Expression in the Human Malaria Parasite, Plasmodium Falciparum, International Journal for Parasitology, vol.47, issue.7, pp.399-407, 2017.

D. S. Guttery, A. Benoit-poulin, R. J. Ramaprasad, . Wall, J. P. David et al., Genome-Wide Functional Analysis of Plasmodium Protein Phosphatases Reveals Key Regulators of Parasite Development and Differentiation, Cell Host and Microbe, vol.16, issue.1, pp.128-168, 2014.

L. Hadariová, M. Vesteg, V. Hampl, and J. Kraj?ovi?, Reductive Evolution of Chloroplasts in Non-Photosynthetic Plants, Algae and Protists, Current Genetics, vol.64, issue.2, pp.365-87, 2018.

M. Hakimi, P. Ali, D. L. Olias, and . Sibley, Toxoplasma Effectors Targeting Host Signaling and Transcription, Clinical Microbiology Reviews, vol.30, issue.3, pp.615-660, 2017.

,

K. Haldar, S. Bhattacharjee, and I. Safeukui, Drug Resistance in Plasmodium, Nature Reviews Microbiology, vol.16, issue.3, pp.156-70, 2018.

. Hallée, N. A. Stéphanie, K. Counihan, T. F. Matthews, D. De-koning-ward et al., The Malaria Parasite Plasmodium Falciparum Sortilin Is Essential for Merozoite Formation and Apical Complex Biogenesis, Cellular Microbiology, 2018.

I. Hallyburton, R. Grimaldi, A. Woodland, B. Baragaña, T. Luksch et al., Screening a Protein Kinase Inhibitor Library against Plasmodium Falciparum, Malaria Journal, vol.16, issue.1, pp.1-11, 2017.

W. L. Hamilton, A. Claessens, T. D. Otto, M. Kekre, R. M. Fairhurst et al., Extreme Mutation Bias and High AT Content in Plasmodium Falciparum, Nucleic Acids Research, vol.45, issue.4, pp.1889-1901, 2017.
URL : https://hal.archives-ouvertes.fr/hal-01989279

,

S. K. Hanks, Genomic Analysis of the Eukaryotic Protein Kinase Superfamily: A Perspective, Genome Biology, vol.4, issue.5, p.111, 2003.

. Hanks, K. Steven, and T. Hunter, The Eukaryotic Protein Kinase Superfamily: Kinase (Catalytic) Domain Structure and Classification, FASEB, vol.9, pp.576-96, 1995.

S. K. Hanks, A. M. Quinn, and T. Hunter, The Protein Kinase Family : Conserved Protein Phylogeny Features and Deduced Phylogeny of the Catalytic Domains, Science, vol.241, issue.4861, pp.42-52, 1988.

K. L. Heckman and L. R. Pease, Gene Splicing and Mutagenesis by PCR-Driven Overlap Extension, Nature Protocols, vol.2, issue.4, pp.924-956, 2007.

E. Hempelmann and K. Krafts, Bad Air, Amulets and Mosquitoes: 2,000 Years of Changing Perspectives on Malaria, Malaria Journal, vol.12, issue.1, 2013.

A. Hendrickx, M. Beullens, H. Ceulemans, A. Tom-den-abt, E. Van-eynde et al., Docking Motif-Guided Mapping of the Interactome of Protein Phosphatase-1, Chemistry and Biology, vol.16, issue.4, pp.365-71, 2009.

,

E. Heroes, J. Rip, M. Beullens, L. Van-meervelt, S. D. Gendt et al., Metals in the Active Site of Native Protein Phosphatase-1, Journal of Inorganic Biochemistry, vol.206, pp.1-5, 2015.

F. A. Hippocrates, EBooks. The Internet Classics Archive

N. Hodson, B. Invergo, J. C. Rayner, and J. S. Choudhary, Palmitoylation and Palmitoyl-Transferases in Plasmodium Parasites, Biochemical Society Transactions, vol.43, issue.2, pp.240-285, 2015.

T. Hollin, C. D. Witte, A. Lenne, C. Pierrot, and J. Khalife, Analysis of the Interactome of the Ser/Thr Protein Phosphatase Type 1 in Plasmodium Falciparum, BMC Genomics, vol.17, issue.1, pp.1-16, 2016.
URL : https://hal.archives-ouvertes.fr/tel-01968039

. Homer, Iliade Homère Chant 22

C. S. Hopp, A. E. Balaban, E. Bushell, O. Billker, J. C. Rayner et al., Palmitoyl Transferases Have Critical Roles in the Development of Mosquito and Liver Stages of Plasmodium, Cellular Microbiology, vol.18, issue.11, pp.1625-1666, 2016.

T. Horii, H. Shirai, L. Jie, K. J. Ishii, N. Q. Palacpac et al., Evidences of Protection against Blood-Stage Infection of Plasmodium Falciparum by the Novel Protein Vaccine SE36, Parasitology International, vol.59, issue.3, pp.380-86, 2010.

,

K. Hu, J. David-s-roos, and . Murray, A Novel Polymer of Tubulin Forms the Conoid of Toxoplasma Gondii, The Journal of Cell Biology, vol.156, issue.6, pp.1039-50, 2002.

,

T. Hunter, A Thousand and One Protein Kinases, Cell, vol.50, pp.823-852, 1987.

M. Huse and J. Kuriyan, The Conformational Plasticity of Protein Kinases, Cell, vol.109, pp.741-750, 2002.

B. Intharabut, H. W. Kingston, K. Srinamon, E. A. Ashley, M. Imwong et al., Artemisinin Resistance and Stage Dependency of Parasite Clearance in Falciparum Malaria, The Journal of Infectious Diseases, pp.1-7, 2019.

T. Ishino, K. Yano, Y. Chinzei, and M. Yuda, Cell-Passage Activity Is Required for the Malarial Parasite to Cross the Liver Sinusoidal Cell Layer, PLoS Biology, vol.2, issue.1, pp.77-84, 2004.

N. Issar, E. Roux, D. Mattei, and A. Scherf, Identification of a Novel PostTranslational Modification in Plasmodium Falciparum: Protein Sumoylation in Different Cellular Compartments, Cellular Microbiology, vol.10, issue.10, pp.1999-2011, 2008.

Y. Ito, K. Toyooka, M. Fujimoto, T. Ueda, T. Uemura et al., The Trans-Golgi Network and the Golgi Stacks Behave Independently during Regeneration after Brefeldin A Treatment in Tobacco BY-2 Cells, Plant and Cell Physiology, vol.58, issue.4, pp.811-832, 2017.

M. V. Itzstein, M. Plebanski, B. M. Cooke, and R. L. Coppel, Hot, Sweet and Sticky: The Glycobiology of Plasmodium Falciparum, Trends in Parasitology, vol.24, issue.5, pp.210-228, 2008.

G. R. Iyer, S. Singh, I. Kaur, S. Agarwal, M. A. Siddiqui et al., , p.207

G. Kumar, Calcium-Dependent Phosphorylation of Plasmodium Falciparum Serine Repeat Antigen 5 Triggers Merozoite Egress, Journal of Biological Chemistry, vol.293, issue.25, pp.9736-9782, 2018.

C. A. Jabeena and A. Rajavelu, Epigenetic Players of Chromatin Structure Regulation in Plasmodium Falciparum, 2019.

Y. Jaffré, Contributions of Social Anthropology to Malaria Control, Encyclopedia of Infectious Diseases: Modern Metholologies, 2007.

J. Janou?kovec, A. Horák, M. Oborník, J. Luke?, and P. Keeling, A Common Red Algal Origin of the Apicomplexan, Dinoflagellate, and Heterokont Plastids, PNAS, vol.107, issue.24, pp.10949-54, 2010.

C. J. Janse, J. Ramesar, and A. P. Waters, Plasmodium Berghei : General Parasitological Methods, 2004.

, High-Efficiency Transfection and Drug Selection of Genetically Transformed Blood Stages of the Rodent Malaria Parasite Plasmodium Berghei, Nature Protocols, vol.1, issue.1, pp.346-56, 2006.

C. J. Janse and A. P. Waters, Plasmodium Berghei: The Application of Cultivation and Purification Techniques to Molecular Studies of Malaria Parasites, Parasitology Today, vol.11, issue.4, pp.80133-80135, 1995.

D. T. Jones, R. William, J. M. Taylor, and . Thornton, The Rapid Generation of Mutation Data Matrices, vol.8, pp.275-82, 1992.

M. L. Jones, S. Das, H. Belda, C. R. Collins, M. J. Blackman et al., A Versatile Strategy for Rapid Conditional Genome Engineering Using LoxP Sites in a Small Synthetic Intron in Plasmodium Falciparum, Scientific Reports, vol.6, pp.1-9, 2015.

G. Kaiser, M. D. Niz, P. Burda, L. Niklaus, R. L. Stanway et al., Generation of Transgenic Rodent Malaria Parasites by Transfection of Cell Culture-Derived Merozoites, Malaria Journal, vol.16, issue.1, p.305, 2017.

N. Kannan and S. S. Taylor, Rethinking Pseudokinases, Cell, vol.133, issue.2, pp.204-209, 2008.

S. Kanodia, G. Kumar, L. Rizzi, A. Pedretti, A. N. Hodder et al., Synthetic Peptides Derived from the C-Terminal 6 KDa Region of Plasmodium Falciparum SERA5 Inhibit the Enzyme Activity and Malaria Parasite Development, Biochimica et Biophysica Acta -General Subjects, vol.1840, issue.9, pp.2765-75, 2014.

,

R. B. Kapust and D. S. Waugh, Escherichia Coli Maltose-Binding Protein Is Uncommonly Effective at Promoting the Solubility of Polypeptides to Which It Is Fused, Protein Science, vol.8, issue.8, pp.1668-74, 1999.

B. Kasstan, K. Hampshire, C. Guest, J. G. Logan, M. Pinder et al., Sniff and Tell: The Feasibility of Using Bio-Detection Dogs as a Mobile Diagnostic Intervention for Asymptomatic Malaria in Sub-Saharan Africa, Journal of Biosocial Science, pp.1-8, 2019.

I. Kaur, M. Zeeshan, E. Saini, A. Kaushik, A. Mohmmed et al., Widespread Occurrence of Lysine Methylation in Plasmodium Falciparum Proteins at Asexual Blood Stages, Scientific Reports, vol.6, pp.1-24, 2016.

,

S. Kehr, E. Jortzik, C. Delahunty, J. R. Yates, S. Rahlfs et al., Protein S -Glutathionylation in Malaria Parasites, Antioxidants & Redox Signaling, vol.15, issue.11, pp.2855-65, 2011.

R. S. Kent, K. Katarzyna, R. Modrzynska, N. Cameron, O. Philip et al., Inducible Developmental Reprogramming Redefines Commitment to Sexual Development in the Malaria Parasite Plasmodium Berghei, Nature Microbiology, vol.3, issue.11, pp.1206-1219, 2018.

K. Kentaro, How Does Toxoplama Gondii Invade Host Cells?, The Journal of Veterinary Medical Science, issue.122, pp.1702-1708, 2018.

J. Khalife, A. Fréville, A. Vandomme, and C. Pierrot, Phosphatases, Encyclopedia of Malaria. Hommel M, 2013.

J. Khalife and C. Pierrot, Phosphatases Are Emerging as Novel Druggable Targets in Plasmodium, Future Microbiology, vol.11, issue.5, pp.603-609, 2016.

A. Khaminets, J. P. Hunn, S. Könen-waisman, Y. O. Zhao, D. Preukschat et al., Coordinated Loading of IRG Resistance GTPases on to the Toxoplasma Gondii Parasitophorous Vacuole, Cellular Microbiology, vol.12, issue.7, pp.939-61, 2010.

C. A. Kim and J. U. Bowie, SAM Domains: Uniform Structure, Diversity of Function, Trends in Biochemical Sciences, vol.28, issue.12, pp.625-653, 2003.

E. W. Kim, M. Santhosh, A. L. Nadipuram, W. D. Tetlow, P. T. Barshop et al., The Rhoptry Pseudokinase ROP54 Modulates Toxoplasma Gondii Virulence and Host GBP2 Loading, MSphere, vol.1, issue.2, pp.1-15, 2016.

,

A. F. King and . Africanus, Insects and Disease -Mosquitoes and Malaria, 1883.

K. Kirk and A. M. Lehane, Membrane Transport in the Malaria Parasite and Its Host Erythrocyte, Biochemical Journal, vol.457, issue.1, pp.1-18, 2014.

M. J. Knape and F. W. Herberg, Metal Coordination in Kinases and Pseudokinases, Biochemical Society Transactions, vol.45, issue.3, pp.653-63, 2017.

B. Kobe, T. Kampmann, J. K. Forwood, P. Listwan, and R. I. Brinkworth, Substrate Specificity of Protein Kinases and Computational Prediction of Substrates, Biochimica et Biophysica Acta -Proteins and Proteomics, vol.1754, issue.1-2, pp.200-209, 2005.

,

T. F. Koning-ward, . De, W. A. Matthew, L. Dixon, P. R. Tilley et al., Plasmodium Species: Master Renovators of Their Host Cells, Nature Reviews Microbiology, vol.14, issue.8, pp.494-507, 2016.

M. Kono, D. Heincke, L. Wilcke, T. W. Wong, C. Bruns et al., , p.209

. Gilberger, Pellicle Formation in the Malaria Parasite, Journal of Cell Science, vol.129, issue.4, pp.673-80, 2016.

A. P. Kornev, M. Nina, S. S. Haste, L. F. Taylor, and . Eyck, Surface Comparison of Active and Inactive Protein Kinases Identifies a Conserved Activation Mechanism, Proceedings of the National Academy of Sciences, vol.103, issue.47, pp.17783-88, 2006.

A. P. Kornev and S. S. Taylor, Defining the Conserved Internal Architecture of a Protein Kinase, Biochimica et Biophysica Acta -Proteins and Proteomics, vol.1804, issue.3, pp.440-484, 2010.

G. Kumar, E. Senthil, S. D. Gokhan, M. Munter, P. Bollen et al., The Ki-67 and RepoMan Mitotic Phosphatases Assemble via an Identical, yet Novel Mechanism, ELife, vol.5, pp.1-15, 2016.

R. Kumar, B. Adams, A. Oldenburg, A. Musiyenko, and S. Barik, Characterisation and Expression of a PP1 Serine/Threonine Proteinphosphatase (PfPP1) from the Malaria Parasite, Plasmodium Falciparum:Demonstration of Its Essential Role Using RNA Interference, Malaria Journal, vol.1, pp.1-11, 2002.

V. Kumar, A. Behl, P. Kapoor, B. Nayak, G. Singh et al., Inner Membrane Complex 1l Protein of Plasmodium Falciparum Links Membrane Lipids with Cytoskeletal Element 'Actin' and Its Associated Motor 'Myosin, International Journal of Biological Macromolecules, vol.126, pp.673-84, 2019.

. Kundu, K. Tapas, and S. Sikder, Evolution of Genome Organization and Epigenetic Machineries, Journal of Biosciences, vol.43, issue.2, pp.239-281, 2018.

M. Kupferschmid, M. Osny-aquino-gil, H. Shams-eldin, J. Schmidt, N. Yamakawa et al., Identification of O-GlcNAcylated Proteins in Plasmodium Falciparum, Malaria Journal, vol.16, issue.1, pp.1-11, 2017.

J. J. Kwan, N. Warner, J. Maini, K. W. Chan-tung, H. Zakaria et al., Saccharomyces Cerevisiae Ste50 Binds the MAPKKK Ste11 through a Head-to-Tail SAM Domain Interaction, Journal of Molecular Biology, vol.356, issue.1, pp.142-54, 2006.

A. Lacampagne, J. Fauconnier, and S. Richard, Medecine Sciences : M/S, vol.24, issue.4, pp.399-405, 2008.

C. Lad, N. H. Williams, and R. Wolfenden, The Rate of Hydrolysis of Phosphomonoester Dianions and the Exceptional Catalytic Proficiencies of Protein and Inositol Phosphatases, Proceedings of the National Academy of Sciences, vol.100, issue.10, pp.5607-5617, 2003.

M. H. Lamarque, S. Besteiro, J. Papoin, M. Roques, B. Vulliez-le-normand et al., The RON2-AMA1 Interaction Is a Critical Step in Moving Junction-Dependent Invasion by Apicomplexan Parasites, PLoS Pathogens, vol.7, issue.2, 2011.

M. H. Lamarque, M. Roques, M. Kong-hap, M. L. Tonkin, G. Rugarabamu et al., Plasticity and Redundancy among AMA-RON Pairs Ensure Host Cell Entry of Toxoplasma Parasites, Nature Communications, vol.5, pp.1-13, 2014.

G. Lamonte, K. A. Walzer, J. Lacsina, C. Nicchitta, and J. Chi, Methods to Investigate the Regulatory Role of Small RNAs and Ribosomal Occupancy of Plasmodium Falciparum, Journal of Visualized Experiments : JoVE, issue.106, 2015.

N. Laronde-leblanc and A. Wlodawer, The RIO Kinases: An Atypical Protein Kinase Family Required for Ribosome Biogenesis and Cell Cycle Progression, Biochimica et Biophysica ActaProteins and Proteomics, vol.1754, issue.1-2, pp.14-24, 2005.

. Lasonder, J. L. Edwin, M. Green, G. Grainger, A. A. Langsley et al., Extensive Differential Protein Phosphorylation as Intraerythrocytic Plasmodium Falciparum Schizonts Develop into Extracellular Invasive Merozoites, Proteomics, vol.15, issue.15, pp.2716-2745, 2015.

E. Lasonder, M. Treeck, M. Alam, and A. B. Tobin, Insights into the Plasmodium Falciparum Schizont Phospho-Proteome, Microbes and Infection, vol.14, issue.10, pp.811-830, 2012.

S. Lauer, J. Vanwye, T. Harrison, H. Mcmanus, B. U. Samuel et al., Vacuolar Uptake of Host Components, and a Role for Cholesterol and Sphingomyelin in Malarial Infection, Narla Mohandas, and Kasturi Haldar, vol.19, pp.3556-64, 2000.

L. Laveran and . Alphonse, Nature Parasitaire Des Accidents de l'impaludisme. BnF Gallica, 1881.

C. Lecointre, V. Simon, C. Kerneur, F. Allemand, A. Fournet et al., Dimerization of the Pragmin Pseudo-Kinase Regulates Protein Tyrosine Phosphorylation, Structure, vol.26, issue.4, pp.545-554, 2018.
URL : https://hal.archives-ouvertes.fr/hal-01872982

A. Lenne, C. D. Witte, G. Tellier, T. Hollin, A. El-moukhtar-aliouat et al., Characterization of a Protein Phosphatase Type-1 and a Kinase Anchoring Protein in Plasmodium Falciparum, Frontiers in Microbiology, vol.9, p.2617, 2018.

C. Leroy, N. V. Belkina, T. Long, E. Deruy, C. Dissous et al., Caspase Cleavages of the Lymphocyte-Oriented Kinase Prevent Ezrin, Radixin, and Moesin Phosphorylation during Apoptosis, Journal of Biological Chemistry, vol.291, pp.10148-61, 2016.

N. D. Levine, Progress in Taxonomy of the Apicomplexan Protozoa, The Journal of Protozoology, vol.35, issue.4, pp.518-538, 1988.

J. Li, T. Mitamura, B. A. Fox, D. J. Bzik, and T. Horii, Differential Localization of Processed Fragments of Plasmodium Falciparum Serine Repeat Antigen and Further Processing of Its N-Terminal 47 KDa Fragment, Parasitology International, vol.51, issue.4, pp.42-51, 2002.

H. Lodish, A. Berk, L. Zipursky, P. Matsudaira, D. Baltimore et al., The Actin Cytoskeleton, 2000.

M. Long, S. Jose-de, W. Souza, and . Gilbert, Evolution of the Intron-Exon Structure of Eukaryotic Genes, Current Opinion in Genetics and Development, vol.5, issue.6, pp.774-78, 1995.

, , pp.80010-80013

. Lopaticki, A. S. Sash, A. Yang, N. E. John, J. P. Scott et al., Protein O-Fucosylation in Plasmodium Falciparum Ensures Efficient Infection of Mosquito and Vertebrate Hosts, Nature Communications, vol.8, issue.1, 2017.

,

A. Lorestani, D. F. Ivey, S. Thirugnanam, M. A. Busby, G. T. Marth et al., Targeted Proteomic Dissection of Toxoplasma Cytoskeleton Sub-Compartments Using MORN1, Cytoskeleton (Hoboken), vol.69, issue.12, pp.1069-85, 2012.

A. Lorestani, L. Sheiner, K. Yang, S. D. Robertson, N. Sahoo et al., A Toxoplasma MORN1 Null Mutant Undergoes Repeated Divisions but Is Defective in Basal Assembly, Apicoplast Division and Cytokinesis, PLoS ONE, vol.5, issue.8, 2010.

A. A. Lover, J. K. Baird, R. Gosling, and R. N. Price, Malaria Elimination: Time to Target All Species, American Journal of Tropical Medicine and Hygiene, vol.99, issue.1, pp.17-23, 2018.

L. M. Low, D. I. Stanisic, and M. F. Good, Exploiting the Apicoplast: ApicoplastTargeting Drugs and Malaria Vaccine Development, Microbes and Infection, vol.20, issue.9, pp.477-83, 2018.

J. Lu, Y. Tong, J. Pan, Y. Yang, Q. Liu et al., A Redesigned CRISPR/Cas9 System for Marker-Free Genome Editing in Plasmodium Falciparum, Parasites & Vectors, vol.9, 0198.

X. Lu, G. Maggie, M. Batugedara, J. Lee, . Prudhomme et al., Nascent RNA Sequencing Reveals Mechanisms of Gene Regulation in the Human Malaria Parasite Plasmodium Falciparum, Nucleic Acids Research, vol.45, issue.13, pp.7825-7865, 2017.

I. S. Lucet, J. Jeffrey, J. M. Babon, and . Murphy, Techniques to Examine Nucleotide Binding by Pseudokinases: Table 1, Biochemical Society Transactions, vol.41, issue.4, pp.975-80, 2013.

M. Lunghi, F. Spano, A. Magini, C. Emiliani, V. B. Carruthers et al., Alternative Splicing Mechanisms Orchestrating Post-Transcriptional Gene Expression: Intron Retention and the Intron-Rich Genome of Apicomplexan Parasites, Current Genetics, vol.62, issue.1, pp.31-38, 2016.

P. J. Lupardus, M. Ultsch, H. Wallweber, P. Bir-kohli, A. R. Johnson et al., Structure of the Pseudokinase-Kinase Domains from Protein Kinase TYK2 Reveals a Mechanism for Janus Kinase (JAK) Autoinhibition, Proceedings of the National Academy of Sciences, vol.111, issue.22, pp.8025-8055, 2014.

A. Luzolo, D. Landela, and . Ngoyi, Cerebral Malaria, Brain Research Bulletin, 2019.

H. Ma, Y. Lou, W. H. Lin, and H. W. Xue, MORN Motifs in Plant PIPKs Are Involved in the Regulation of Subcellular Localization and Phospholipid Binding, Cell Research, vol.16, issue.5, pp.466-78, 2006.

G. R. Mair, E. Lasonder, L. S. Garver, M. D. Blandine, C. K. Franke-fayard et al., Universal Features of Post-Transcriptional Gene Regulation Are Critical for Plasmodium Zygote Development, PLoS Pathogens, vol.6, issue.2, 2010.

, AnAPN1 Antigen in Transmission-Blocking Vaccines, Fact Sheet, vol.2

G. Manning, D. Whyte, R. Martinez, S. Hunter, and . Sudarsanam, The Protein Kinase Complement of the Human Genome, Science, p.298, 2000.

M. B. Markus, Dormancy in Mammalian Malaria, Trends in Parasitology, vol.28, issue.2, pp.39-45, 2012.

W. Martin, T. Rujan, E. Richly, A. Hansen, S. Cornelsen et al., Evolutionary Analysis of Arabidopsis, Cyanobacterial, and Chloroplast Genomes Reveals Plastid Phylogeny and Thousands of Cyanobacterial Genes in the Nucleus, PNAS, vol.99, pp.1-6, 2002.

M. Maruthi, D. Singh, B. S. Segireddy-rameswara-reddy, S. Mastan, K. Mishra et al., Modulation of Host Cell SUMOylation Facilitates Efficient Development of Plasmodium Berghei and Toxoplasma Gondii, Cellular Microbiology, vol.19, issue.7, pp.1-13, 2017.

E. S. Mathews and A. R. Odom-john, Tackling Resistance: Emerging Antimalarials and New Parasite Targets in the Era of Elimination, F1000Research, vol.7, issue.0, p.1170, 2018.

. Matthews, C. W. Holly, C. J. Duffy, and . Merrick, Checks and Balances? DNA Replication and the Cell Cycle in Plasmodium, Parasites and Vectors, vol.11, issue.1, pp.1-13, 2018.

K. M. Matthews, L. Ethan, T. F. Pitman, and . De-koning-ward, Illuminating How Malaria Parasites Export Proteins into Host Erythrocytes, Cellular Microbiology, 2019.

G. Mcfadden and . Ian, Plasmodium: More Don'ts, Trends in Parasitology, vol.35, issue.1, pp.4-6, 2018.

G. Mcfadden, E. Ian, and . Yeh, The Apicoplast: Now You See It, Now You Don't, International Journal for Parasitology, vol.47, issue.2-3, pp.137-181, 2017.

E. Meibalan and M. Marti, The Biology of Malaria Transmission, Recent Advances in Malaria, vol.7, pp.87-124, 2017.

E. Meibalan, M. A. Comunale, A. M. Lopez, L. W. Bergman, A. Mehta et al., Host Erythrocyte Environment Influences the Localization of Exported Protein 2, an Essential Component of the Plasmodium Translocon, Eukaryotic Cell, vol.14, issue.4, pp.371-84, 2015.

H. Meiselbach, H. Sticht, and R. Enz, Structural Analysis of the Protein Phosphatase 1 Docking Motif: Molecular Description of Binding Specificities Identifies Interacting Proteins, Chemistry and Biology, vol.13, issue.1, pp.49-59, 2006.

R. Ménard, J. Tavares, I. Cockburn, M. Markus, F. Zavala et al., Looking under the Skin: The First Steps in Malarial Infection and Immunity, Nature Reviews Microbiology, vol.11, issue.10, pp.701-713, 2013.

S. R. Meshnick, Artemisinin: Mechanisms of Action, Resistance and Toxicity, International Journal for Parasitology, vol.32, pp.194-201, 2002.

L. H. Miller, I. Dror, K. Baruch, O. Marsh, and . Doumbo, The Pathogenic Basis of Malaria, vol.415, pp.673-79, 2002.

S. K. Miller, T. Robert, D. R. Good, M. Drew, P. R. Delorenzi et al., A Subset of Plasmodium Falciparum SERA Genes Are Expressed and Appear to Play an Important Role in the Erythrocytic Cycle, Journal of Biological Chemistry, vol.277, issue.49, pp.47524-47556, 2002.

D. A. Milner, Malaria Pathogenesis, Cold Spring Harbor Perspectives in Medicine, vol.8, issue.1, 2018.

M. E. Milton and S. W. Nelson, Replication and Maintenance of the Plasmodium Falciparum Apicoplast Genome, Molecular and Biochemical Parasitology, vol.208, issue.2, pp.56-64, 2016.

X. Min, M. H. Byung-hoon-lee, E. J. Cobb, and . Goldsmith, Crystal Structure of the Kinase Domain of WNK1, a Kinase That Causes a Hereditary Form of Hypertension, Structure, vol.12, issue.7, pp.1303-1314, 2004.

D. F. Mitcheson, B. Andrew, M. M. Tobin, and . Alam, Applying Chemical Genetic Tools to the Study of Phospho-Signalling Pathways in Malaria Parasites, Biochimica et Biophysica Acta -Proteins and Proteomics, vol.1854, issue.10, pp.1650-56, 2015.

H. Möbitz, The ABC of Protein Kinase Conformations, Biochimica et Biophysica Acta -Proteins and Proteomics, vol.1854, issue.10, pp.1555-66, 2015.

K. Modrzynska, C. Pfander, L. Chappell, L. Yu, C. Suarez et al., A Knockout Screen of ApiAP2 Genes Reveals Networks of Interacting Transcriptional Regulators Controlling the Plasmodium Life Cycle, Cell Host & Microbe, vol.21, issue.1, pp.11-22, 2017.

A. Monroe, S. Moore, H. Koenker, M. Lynch, and E. Ricotta, Measuring and Characterizing Night Time Human Behaviour as It Relates to Residual Malaria Transmission in SubSaharan Africa: A Review of the Published Literature, Malaria Journal, vol.18, issue.1, 2019.

R. B. Moore, M. Oborník, J. Janou?kovec, T. Chrudimský, M. Vancová et al., A Photosynthetic Alveolate Closely Related to Apicomplexan Parasites, Nature, vol.451, issue.7181, pp.959-63, 2008.

B. Mordmüller, M. Sulyok, D. Egger-adam, M. Resende, W. A. De-jongh et al., First-in-Human, Randomized, Double-Blind Clinical Trial of Differentially Adjuvanted PAMVAC, a Vaccine Candidate to Prevent Pregnancy-Associated Malaria, Clinical Infectious Diseases, 2019.

D. G. Mordue, N. Desai, M. Dustin, and L. Sibley, Proteins on the Basis of Their Membrane Anchoring, J. Exp. Med, vol.190, issue.12, pp.1783-92, 1999.

D. O. Morgan, Principles of CDK Regulation, Nature, vol.374, issue.6518, pp.131-165, 1995.

M. Morita, H. Nagaoka, E. H. Ntege, B. N. Kanoi, D. Ito et al., PV1, a Novel Plasmodium Falciparum Merozoite Dense Granule Protein, Interacts with Exported Protein in Infected Erythrocytes, Scientific Reports, vol.8, issue.1, pp.1-11, 2018.

,

N. S. Morrissette and D. L. Sibley, Cytoskeleton of Apicomplexan Parasites, MICROBIOLOGY AND MOLECULAR BIOLOGY REVIEWS, vol.66, issue.1, pp.21-38, 2002.

,

E. Mossessova, R. A. Corpina, and J. Goldberg, Crystal Structure of ARF1?Sec7 Complexed with Brefeldin A and Its Implications for the Guanine Nucleotide Exchange Mechanism, Molecular Cell, vol.12, issue.6, pp.475-476, 2003.

M. Moura, M. Osswald, N. Leça, J. Barbosa, A. J. Pereira et al., Protein Phosphatase 1 Inactivates Mps1 to Ensure Efficient Spindle Assembly Checkpoint Silencing, ELife, vol.6, pp.1-29, 2017.

K. Mukherjee, M. Sharma, H. Urlaub, P. Gleb, . Bourenkov et al., CASK Functions as a Mg2+-Independent Neurexin Kinase, Cell, vol.133, issue.2, pp.328-367, 2008.

E. Mundwiler-pachlatko and H. Beck, Maurer's Clefts, the Enigma of Plasmodium Falciparum, Proceedings of the National Academy of Sciences, vol.110, issue.50, pp.19987-94, 2013.

R. P. Munton, S. Vizi, and I. M. Mansuy, The Role of Protein Phosphatase-1 in the Modulation of Synaptic and Structural Plasticity, FEBS Letters, vol.567, issue.1, pp.121-149, 2004.

J. M. Murphy, Q. Zhang, S. N. Young, M. L. Reese, F. P. Bailey et al., A Robust Methodology to Subclassify Pseudokinases Based on Their Nucleotide-Binding Properties, Biochemical Journal, vol.457, issue.2, pp.323-357, 2014.

,

. Nasa, S. F. Isha, A. N. Rusin, G. B. Kettenbach, and . Moorhead, Aurora B Opposes PP1 Function in Mitosis by Phosphorylating the Conserved PP1-Binding RVxF Motif in PP1 Regulatory Proteins, Science Signaling, vol.11, issue.530, 2018.

R. C. Newton and . 1895, Some Observations Which Appear to Establish the Aërial Transportation of Malarial Germs, Transactions of the American Climatological Association for the Year ... American Climatological Association, vol.11, pp.91-111

B. Ngoubangoye, L. Boundenga, C. Arnathau, M. Illich, P. Mombo et al., The Host Specificity of Ape Malaria Parasites Can Be Broken in Confined Environments, International Journal for Parasitology, vol.46, issue.11, pp.737-781, 2016.
URL : https://hal.archives-ouvertes.fr/hal-01957730

A. T. Nguyen, M. A. Prado, P. J. Schmidt, T. Anoop, J. T. Sendamarai et al., UBE2O Remodels the Proteome during Terminal Erythroid Differentiation, Science, vol.357, issue.6350, pp.1-22, 2017.

M. Niz, E. De, P. Meibalan, S. Mejia, N. M. Ma et al., Plasmodium Gametocytes Display Homing and Vascular Transmigration in the Host Bone Marrow, Science Advances, vol.4, issue.5, pp.1-16, 2018.

,

B. Nolen, S. Taylor, and G. Ghosh, Regulation of Protein Kinases: Controlling Activity through Activation Segment Conformation, Molecular Cell, vol.15, issue.5, pp.661-75, 2004.

,

M. C. Nunes, M. Okada, C. Scheidig-benatar, B. M. Cooke, and A. Scherf, Plasmodium Falciparum Fikk Kinase Members Target Distinct Components of the Erythrocyte Membrane, PLoS ONE, vol.5, issue.7, pp.1-8, 2010.

M. Oborník, D. Modrý, M. Luke?, E. ?ernotíková-st?íbrná, J. Cihlá? et al., Morphology, Ultrastructure and Life Cycle of Vitrella Brassicaformis n. Sp., n. Gen., a Novel Chromerid from the Great Barrier Reef, Protist, vol.163, issue.2, pp.306-329, 2012.

E. Ogola, J. Villinger, D. Mabuka, D. Omondi, B. Orindi et al., Composition of Anopheles Mosquitoes, Their BloodMeal Hosts, and Plasmodium Falciparum Infection Rates in Three Islands with Disparate Bed Net Coverage in Lake Victoria, Kenya, Malaria Journal, vol.16, issue.1, pp.1-12, 2017.

N. Palacpac, Q. Marie, A. Edward-ntege, B. Yeka, N. Balikagala et al., Phase 1b Randomized Trial and Follow-Up Study in Uganda of the Blood-Stage Malaria Vaccine Candidate BK-SE36, PLoS ONE, vol.8, issue.5, 2013.

,

N. Palacpac, Q. Marie, N. Arisue, T. Tougan, K. J. Ishii et al., Plasmodium Falciparum Serine Repeat Antigen 5 (SE36) as a Malaria Vaccine Candidate, Vaccine, vol.29, issue.35, pp.5837-5882, 2011.

L. Paloque, B. Witkowski, J. Lelièvre, M. Ouji, T. Ben-haddou et al., Endoperoxide-Based Compounds: Cross-Resistance with Artemisinins and Selection of a Plasmodium Falciparum Lineage with a K13 Non-Synonymous Polymorphism, Journal of Antimicrobial Chemotherapy, pp.395-403, 2017.
URL : https://hal.archives-ouvertes.fr/hal-01963522

,

R. Pandey, A. Mohmmed, C. Pierrot, J. Khalife, P. Malhotra et al., Genome Wide in Silico Analysis of Plasmodium Falciparum Phosphatome, BMC Genomics, vol.15, issue.1, pp.1-22, 2014.

X. Pang, T. Li, and . Horii, Complement-Mediated Killing of Plasmodium Falciparum Erythrocytic Schizont with Antibodies to the Recombinant Serine Repeat Antigen (SERA), Vaccine, vol.16, issue.13, pp.57-64, 1998.

X. Pang, T. Li, T. Mitamura, and . Horii, Antibodies Reactive with the N-Terminal Domain of Plasmodium Falciparum Serine Repeat Antigen Inhibit Cell Proliferation by Agglutinating Merozoites and Schizonts, Infection and Immunity, vol.67, issue.4, pp.1821-1848, 1999.

C. Park, H. G. Ho, S. Ryu, D. Kim, H. Lee et al., Presumed Pseudokinase VRK3 Functions as a BAF Kinase, Biochimica et Biophysica Acta (BBA) -Molecular Cell Research, vol.1853, issue.7, pp.1738-1786, 2015.

G. Paul, A. Deshmukh, I. Kaur, S. Rathore, S. Dabral et al., A Novel Pfs38 Protein Complex on the Surface of Plasmodium Falciparum Blood-Stage Merozoites, Malaria Journal, vol.16, issue.1, pp.1-15, 2017.

M. G. Paulick and C. R. Bertozzi, The Glycosylphosphatidylinositol Anchor : A Complex Membrane-Anchoring, BIochemistry, vol.47, pp.6991-7000, 2008.

B. N. Pease, L. Edward, M. P. Huttlin, E. Jedrychowski, J. Talevich et al., Global Analysis of Protein Expression and Phosphorylation of Three Stages of Plasmodium Falciparum Intraerythrocytic Development, Journal of Proteome Research, vol.12, issue.9, pp.4028-4073, 2013.

L. Peixoto, F. Chen, O. S. Harb, P. H. Davis, D. P. Beiting et al., Integrative Genomic Approaches Highlight a Family of Parasite-Specific Kinases That Regulate Host Responses, Cell Host & Microbe, vol.8, issue.2, pp.208-226, 2010.

A. Pérez-gallegos, M. Garcia-viloca, À. González-lafont, and J. M. Lluch, A QM/MM Study of the Associative Mechanism for the Phosphorylation Reaction Catalyzed by Protein Kinase A and Its D166A Mutant, Journal of Computer-Aided Molecular Design, vol.28, issue.11, pp.1077-91, 2014.

G. H. Perry, Parasites and Human Evolution, Evolutionary Anthropology, vol.23, issue.6, pp.218-246, 2014.

J. Petithory, A Propos de La Découverte de l'hématozoaire Du Paludisme Par A. Laveran Bône 1878 -Constantine 1880*, Histoire Des Sciences Medicales, vol.1, p.57, 1995.

N. Philip and A. P. Waters, Conditional Degradation of Plasmodium Calcineurin Reveals Functions in Parasite Colonization of Both Host and Vector, Cell Host and Microbe, vol.18, issue.1, pp.122-153, 2015.

M. A. Phillips, J. N. Burrows, C. Manyando, R. Hooft-van-huijsduijnen, W. C. Van-voorhis et al., Malaria, Nature Reviews -Disease Primers, vol.3, 2017.

C. Pierrot, A. Freville, C. Olivier, V. Souplet, and J. Khalife, Inhibition of Protein-Protein Interactions in Plasmodium Falciparum: Future Drug Targets, Current Pharmaceutical Design, vol.18, issue.24, pp.3522-3552, 2012.

C. Pierrot, X. Zhang, G. Zanghi, A. Fréville, A. Rebollo et al., Peptides Derived from <em>Plasmodium Falciparum</Em> Leucine-Rich Repeat 1 Bind to Serine/Threonine Phosphatase Type 1 and Inhibit Parasite Growth in Vitro, Drug Design, Development and Therapy, vol.12, pp.85-88, 2018.

A. Planson, J. I. Gaëlle, M. E. Guijarro, A. F. Goldberg, and . Chaffotte, Assistance of Maltose Binding Protein to the in Vivo Folding of the Disulfide-Rich C-Terminal Fragment from Plasmodium Falciparum Merozoite Surface Protein 1 Expressed in Escherichia Coli, Biochemistry, vol.42, issue.45, pp.13202-13213, 2003.
URL : https://hal.archives-ouvertes.fr/pasteur-00364798

E. L. Ponder, E. Victoria, B. A. Albrown, M. Leader, J. Békés et al., Functional Characterization of a SUMO Deconjugating Protease of Plasmodium Falciparum Using Newly Identified Small Molecule Inhibitors, Chem Biol, vol.18, issue.6, pp.711-732, 2011.

C. P. Ponting, SAM: A Novel Motif in Yeast Sterile and Drosophila Polyhomeotic, Molecular And General Genetics, pp.1928-1958, 1995.

N. Ponts, A. Saraf, D. Duk-wong, A. Chung, J. Harris et al., Unraveling the Ubiquitome of the Human Malaria Parasite, The Journal of Biological Chemistry, vol.286, pp.40320-40350, 2011.

,

A. Poran, C. Nötzel, O. Aly, N. Mencia-trinchant, T. H. Chantal et al., Single-Cell RNA-Seq Reveals a Signature of Sexual Commitment in Malaria Parasites, Nature, vol.551, issue.7678, pp.95-99, 2017.

G. Pradel and U. Frevert, Malaria Sporozoites Actively Enter and Pass through Rat Kupffer Cells Prior to Hepatocyte Invasion, Hepatology, vol.33, issue.5, pp.1154-65, 2001.

,

P. Prommana, C. Uthaipibull, C. Wongsombat, S. Kamchonwongpaisan, Y. Yuthavong et al., Inducible Knockdown of Plasmodium Gene Expression Using the GlmS Ribozyme, PLoS ONE, vol.8, issue.8, pp.1-10, 2013.

J. M. Przyborski, K. Susanne, J. M. Miller, P. P. Pfahler, P. Henrich et al., Trafficking of STEVOR to the Maurer's Clefts in Plasmodium Falciparum-Infected Erythrocytes, EMBO Journal, vol.24, issue.13, pp.2306-2323, 2005.

,

J. M. Przyborski, B. Nyboer, and M. Lanzer, Ticket to Ride: Export of Proteins to the Plasmodium Falciparum-Infected Erythrocyte, Molecular Microbiology, vol.101, issue.1, pp.1-11, 2016.

. Pulcini, H. M. Serena, A. H. Staines, S. H. Lee, G. Shafik et al., Mutations in the Plasmodium Falciparum Chloroquine Resistance Transporter, PfCRT, Enlarge the Parasite's Food Vacuole and Alter Drug Sensitivities, Scientific Reports, vol.5, pp.1-16, 2015.

E. D. Putrianti, A. Schmidt-christensen, I. Arnold, T. Volker, K. Heussler et al., The Plasmodium Serine-Type SERA Proteases Display Distinct Expression Patterns and Non-Essential in Vivo Roles during Life Cycle Progression of the Malaria Parasite, Cellular Microbiology, vol.12, issue.6, pp.725-764, 2010.

F. Qiao and J. U. Bowie, The Many Faces of SAM, Science's STKE, vol.123, issue.6, pp.993-99, 2005.

M. J. Ragusa, B. Dancheck, A. David, A. C. Critton, R. Nairn et al., Spinophilin Directs Protein Phosphatase 1 Specificity by Blocking Substrate Binding Sites, Nature Structural Molecular Biology, vol.17, issue.4, pp.459-64, 2010.

S. A. Ralph, G. Giel, R. F. Van-dooren, M. J. Waller, M. J. Crawford et al., Metabolic Maps and Functions of the Plasmodium Falciparum Apicoplast, Nature Reviews Microbiology, vol.2, issue.3, pp.203-219, 2004.

R. Ramachander and J. U. Bowie, SAM Domains Can Utilize Similar Surfaces for the Formation of Polymers and Closed Oligomers, Journal of Molecular Biology, vol.342, issue.5, pp.1353-58, 2004.

S. Rebelo, M. Santos, F. Martins, E. F. Da-cruz-e-silva, A. B. Odete et al., Protein Phosphatase 1 Is a Key Player in Nuclear Events, Cellular Signalling, vol.27, issue.12, pp.2589-98, 2015.

B. P. Reddy, S. Niranjan, K. J. Shrestha, X. Hart, K. Liang et al., , p.218

E. Scott and . Lindner, A Bioinformatic Survey of RNA-Binding Proteins in Plasmodium, BMC Genomics, vol.16, issue.1, pp.1-26, 2015.

M. L. Reese and J. C. Boothroyd, A Conserved Non-Canonical Motif in the Pseudoactive Site of the ROP5 Pseudokinase Domain Mediates Its Effect on Toxoplasma Virulence, Journal of Biological Chemistry, vol.286, issue.33, pp.29366-75, 2011.

M. L. Reese and J. P. Boyle, Virulence without Catalysis: How Can a Pseudokinase Affect Host Cell Signaling?, Trends in Parasitology, vol.28, issue.2, pp.53-57, 2012.

M. L. Reese, J. C. Shah, and . Boothroyd, The Toxoplasma Pseudokinase ROP5 Is an Allosteric Inhibitor of the Immunity-Related GTPases, Journal of Biological Chemistry, vol.289, issue.40, pp.27849-58, 2014.

A. J. Reid, M. Arthur, H. M. Talman, A. R. Bennett, M. J. Gomes et al., Single-Cell RNASeq Reveals Hidden Transcriptional Variation in Malaria Parasites, ELife, vol.7, pp.1-29, 2018.

M. D. Resh, Trafficking and Signaling by Fatty-Acylated and Prenylated Proteins, Nature Chemical Biology, vol.2, issue.11, pp.584-90, 2006.

J. Richter, G. Franken, M. C. Holtfreter, S. Walter, A. Labisch et al., Clinical Implications of a Gradual Dormancy Concept in Malaria, Parasitology Research, vol.115, issue.6, pp.2139-2187, 2016.

. Risco-castillo, S. Veronica, C. Topçu, G. Marinach, A. E. Manzoni et al., Malaria Sporozoites Traverse Host Cells within Transient Vacuoles, Cell Host and Microbe, vol.18, issue.5, pp.593-603, 2015.
URL : https://hal.archives-ouvertes.fr/hal-01226222

A. Rivkin, S. Ben-hur, and N. Regev-rudzki, Malaria Parasites Distribute Subversive Messages across Enemy Lines, Trends in Parasitology, vol.33, issue.1, pp.2-4, 2017.

,

L. Roberts, Drug-Resistant Malaria Advances in Mekong, Science Mag, vol.358, issue.6360, pp.155-56, 2017.

S. Rogerson, L. Hviid, P. E. Duffy, F. G. Rose, D. W. Leke et al., Malaria in Pregnancy: Pathogenesis and Immunity, Lancet Infectious Diseases, vol.7, pp.105-116, 2007.

, , pp.70022-70023

R. Ross, Report on the Cultivation of Proteosoma, Labbé, in Grey Mosquito -Concluded from Page 408, The Indian Medical Gazette, 1898.

. Rts-s-clinical-trials and . Partnership, Efficacy and Safety of RTS,S/AS01 Malaria Vaccine with or without a Booster Dose in Infants and Children in Africa: Final Results of a Phase 3, Individually Randomised, Controlled Trial, The Lancet, vol.386, issue.9988, pp.60721-60729, 2015.

P. F. Russell, Malaria and Its Influence on World Health, 1943.

S. Sabbatani, R. Manfredi, and S. Fiorino, Malaria Infection and Human Evolution, Le Infezioni in Medicina, vol.1, pp.56-74, 2010.

J. Saïssy, Paludisme Grave. ARNETTE GR, 2001.

N. Sampaio, L. Guimaraes, E. M. Cheng, and . Eriksson, The Role of Extracellular Vesicles in Malaria Biology and Pathogenesis, Malaria Journal, vol.16, issue.1, pp.1-11, 2017.

B. U. Samuel, N. Mohandas, T. Harrison, H. Mcmanus, W. Rosse et al., The Role of Cholesterol and Glycosylphosphatidylinositol-Anchored Proteins of Erythrocyte Rafts in Regulating Raft Protein Content and Malarial Infection, Journal of Biological Chemistry, vol.276, issue.31, pp.29319-29348, 2001.

E. D. Scheeff, J. Eswaran, G. Bunkoczi, S. Knapp, and G. Manning, Structure of the Pseudokinase VRK3 Reveals a Degraded Catalytic Site, a Highly Conserved Kinase Fold, and a Putative Regulatory Binding Site, Structure, vol.17, issue.1, pp.128-166, 1993.

K. B. Seydel, D. Samuel, C. Kampondeni, M. J. Valim, D. A. Potchen et al., Brain Swelling and Death in Children with Cerebral Malaria, New England Journal of Medicine, vol.372, issue.12, pp.1126-1163, 2015.

A. Sharma, I. Sharma, D. Kogkasuriyachai, and N. Kumar, Structure of a Gametocyte Protein Essential for Sexual Development in Plasmodium Falciparum, Nature Structural Biology, vol.10, issue.3, pp.197-203, 2003.

D. Sharma, R. Soni, P. Rai, B. Sharma, and T. Bhatt, Relict Plastidic Metabolic Process as a Potential Therapeutic Target, Drug Discovery Today, vol.23, issue.1, pp.134-174, 2018.

P. Sharma and C. E. Chitnis, Key Molecular Events during Host Cell Invasion by Apicomplexan Pathogens, Current Opinion in Microbiology, vol.16, issue.4, pp.432-469, 2013.

,

A. S. Shaw, P. Alexandr, J. Kornev, . Hu, G. Lalima et al., Kinases and Pseudokinases: Lessons from RAF, Molecular and Cellular Biology, vol.34, issue.9, pp.1538-1584, 2014.

M. J. Shears, Y. Cyrille, G. I. Botté, and . Mcfadden, Fatty Acid Metabolism in the Plasmodium Apicoplast: Drugs, Doubts and Knockouts, vol.199, pp.34-50, 2015.

. Shi, S. E. Fumin, Y. Telesco, R. Liu, M. A. Radhakrishnan et al., ErbB3/HER3 Intracellular Domain Is Competent to Bind ATP and Catalyze Autophosphorylation, Proceedings of the National Academy of Sciences, vol.107, issue.17, pp.7692-97, 2010.

,

D. L. Sibley, Invasion and Intracellular Survival by Protozoan Parasites, Immunological Reviews, vol.240, issue.1, pp.72-91, 2011.

A. Sicard, J. P. Semblat, C. Doerig, R. Hamelin, M. Moniatte et al., Activation of a PAK-MEK Signalling Pathway in Malaria Parasite-Infected Erythrocytes, Cellular Microbiology, vol.13, issue.6, pp.836-881, 2011.

S. Junior, G. Bezerra-da, J. Pinto, E. Barros, G. Farias et al., Kidney Involvement in Malaria: An Update, pp.1-6, 2016.

B. Simon, A. S. Huart, and M. Wilmanns, Molecular Mechanisms of Protein Kinase Regulation by Calcium/Calmodulin, Bioorganic and Medicinal Chemistry, vol.23, issue.12, pp.2749-60, 2015.

A. Sinha, K. R. Hughes, K. Katarzyna, . Modrzynska, D. Thomas et al., A Cascade of DNA Binding Proteins for Sexual Commitment and Development in Plasmodium, Nature, vol.507, issue.7491, pp.253-57, 2014.

,

R. C. Smith, J. G. King, D. Tao, A. Oana, C. Zeleznik et al., Molecular Profiling of Phagocytic Immune Cells in Anopheles Gambiae Reveals Integral Roles for Hemocytes in Mosquito Innate Immunity, Molecular & Cellular Proteomics, vol.15, issue.11, pp.3373-87, 2016.

A. C. Sodero, B. Rennó, P. Abrahim-vieira, P. G. Torres, . Pascutti et al., Insights into Cytochrome Bc1 Complex Binding Mode of Antimalarial 2-Hydroxy-1,4-Naphthoquinones through Molecular Modelling, Memorias Do Instituto Oswaldo Cruz, vol.112, issue.4, pp.299-308, 2017.

. Soldati-favre, B. J. Dominique, A. F. Foth, and . Cowman, Molecular and Functional Aspects of Parasite Invasion, Trends in Parasitology, vol.20, issue.12, 2004.

L. Sologub, A. Kuehn, S. Kern, J. Przyborski, R. Schillig et al., Malaria Proteases Mediate Inside-out Egress of Gametocytes from Red Blood Cells Following Parasite Transmission to the Mosquito, Cellular Microbiology, vol.13, issue.6, pp.897-912, 2011.

L. Solyakov, J. Halbert, M. Mahmood, J. P. Alam, D. Semblat et al., Global Kinomic and Phospho-Proteomic Analyses of the Human Malaria Parasite Plasmodium Falciparum, Nature Communications, vol.2, issue.1, pp.512-65, 2011.

N. J. Spillman, J. R. Beck, and D. E. Goldberg, Protein Export into Malaria ParasiteInfected Erythrocytes: Mechanisms and Functional Consequences, Annual Review of Biochemistry, vol.84, issue.1, pp.813-854, 2015.

. Sreelatha, S. S. Anju, V. A. Yee, . Lopez, C. Brenden et al., Protein AMPylation by an Evolutionarily Conserved Pseudokinase, Cell, vol.175, issue.3, pp.809-821, 2018.

R. Stallmach, M. Kavishwar, C. Withers-martinez, F. Hackett, C. R. Collins et al., Plasmodium Falciparum SERA5 Plays a NonEnzymatic Role in the Malarial Asexual Blood-Stage Lifecycle, Molecular Microbiology, vol.96, issue.2, pp.368-87, 2015.

I. Stancik, . Andreas, B. Martin-sebastijan-?estak, M. Ji, D. Axelson-fisk et al., Serine/Threonine Protein Kinases from Bacteria, Archaea and Eukarya Share a Common Evolutionary Origin Deeply Rooted in the Tree of Life, Journal of Molecular Biology, vol.430, issue.1, pp.27-32, 2018.

D. Stapleton, I. Balan, T. Pawson, and F. Sicheri, The Crystal Structure of an Eph Receptor SAM Domain Reveals a Mechanism for Modular Dimerization, Nature Structural Biology, vol.6, issue.1, pp.44-49, 1999.

F. G. Tadesse, L. Meerstein-kessel, P. Bronner, C. Gonçalves, L. Drakeley et al., Gametocyte Sex Ratio: The Key to Understanding Plasmodium Falciparum Transmission?, Trends in Parasitology, vol.xx, pp.1-13, 2018.

,

H. Takeshima, S. Komazaki, M. Nishi, M. Iino, and K. Kangawa, Junctophilins: A Novel Family of Junctional Membrane Complex Proteins, Molecular Cell, vol.6, issue.1, pp.3-4, 2000.

E. Talevich, N. Kannan, and D. Miranda-saavedra, Current Classification of Apicomplexan Kinomes, Protein Phosphorylation in Parasites, pp.19-22, 2013.

E. Talevich, A. Mirza, and N. Kannan, Structural and Evolutionary Divergence of Eukaryotic Protein Kinases in Apicomplexa, BMC Evolutionary Biology, vol.11, issue.1, p.321, 2011.

E. Talevich, A. B. Tobin, N. Kannan, and C. Doerig, An Evolutionary Perspective on the Kinome of Malaria Parasites, Philosophical Transactions of the Royal Society B: Biological Sciences, vol.367, pp.2607-2625, 1602.

S. Tannous and E. Ghanem, A Bite to Fight: Front-Line Innate Immune Defenses against Malaria Parasites, Pathogens and Global Health, vol.112, issue.1, pp.1-12, 2018.

,

D. Tao, B. Mcgill, T. Hamerly, T. Kobayashi, P. Khare et al., A Saliva-Based Rapid Test to Quantify the Infectious Subclinical Malaria Parasite Reservoir, Science Translational Medicine, vol.11, 2019.

,

S. S. Taylor, M. Malik, J. M. Keshwani, A. P. Steichen, and . Kornev, Evolution of the Eukaryotic Protein Kinases as Dynamic Molecular Switches, Philosophical Transactions of the Royal Society B: Biological Sciences, vol.367, pp.2517-2545, 1602.

S. S. Taylor and . Kornev, Protein Kinases: Evolution of Dynamic Regulatory Proteins, Trends in Biochemical Sciences, vol.36, issue.2, pp.65-77, 2011.

,

G. Tellier, A. Lenne, K. Cailliau-maggio, A. Cabezas-cruz, J. J. Valdés et al., Identification of Plasmodium Falciparum Translation Initiation EIF2? Subunit: Direct Interaction with Protein Phosphatase Type 1, Frontiers in Microbiology, vol.7, pp.1-16, 2016.

R. Tewari, U. Straschil, A. Bateman, U. Böhme, I. Cherevach et al., The Systematic Functional Analysis of Plasmodium Protein Kinases Identifies Essential Regulators of Mosquito Transmission, Cell Host and Microbe, vol.8, issue.4, pp.377-87, 2010.

T. Thavayogarajah, P. Gangopadhyay, S. Rahlfs, K. Becker, K. Lingelbach et al., Alternative Protein Secretion in the Malaria Parasite Plasmodium Falciparum, PLoS ONE, vol.10, issue.4, pp.1-18, 2015.

E. E. Thompson, P. Alexandr, N. Kornev, C. Kannan, L. F. Kim et al., Comparative Surface Geometry of the Protein Kinase Family, Protein Science, vol.18, issue.10, pp.2016-2042, 2009.

C. J. Tonkin, J. Bernardo, . Foth, A. Stuart, N. Ralph et al., Evolution of Malaria Parasite Plastid Targeting Sequences, Proceedings of the National Academy of Sciences of the United States of America, vol.105, issue.12, pp.4781-85, 2008.

M. L. Tonkin, M. Roques, H. Mauld, M. Lamarque, D. Pugnière et al., Host Cell Invasion by Apicomplexan Parasites: Insights from the Co-Structure of AMA1 with a RON2 Peptide, Science, vol.333, issue.6041, pp.463-67, 2011.
URL : https://hal.archives-ouvertes.fr/hal-02115756

M. Torii, H. John, . Adams, H. Louis, M. Miller et al., Release of Merozoite Dense Granules during Erythrocyte Invasion by Plasmodium Knowlesi, Infection and Immunity, vol.57, issue.10, pp.3230-3263, 1989.

W. Trager and J. B. Jensen, Human Malaria Parasites in Continuous Culture, Science, vol.193, issue.4254, pp.673-75, 1976.

A. Trampuz, M. Jereb, I. Muzlovic, and R. M. Prabhu, Clinical Review: Severe Malaria, Critical Care, vol.7, issue.4, pp.315-338, 2003.

J. A. Traverso, C. Giglione, and T. Meinnel, High-Throughput Profiling of NMyristoylation Substrate Specificity across Species Including Pathogens, Proteomics, vol.13, issue.1, pp.25-36, 2013.

. Treeck, J. L. Moritz, J. E. Sanders, J. C. Elias, and . Boothroyd, The Phosphoproteomes of Plasmodium Falciparum and Toxoplasma Gondii Reveal Unusual Adaptations within and beyond the Parasites' Boundaries, Cell Host and Microbe, vol.10, issue.4, pp.410-429, 2011.

,

D. K. Treiber and N. P. Shah, Ins and Outs of Kinase DFG Motifs, Chemistry and Biology, vol.20, issue.6, pp.745-791, 2013.

R. K. Trench and R. J. Blank, Gymnodinioid Dinoflagellate Symbionts of Marine Invertebrates, vol.23, pp.469-81, 1987.

L. Trinkle-mulcahy, J. E. Sleeman, and A. I. Lamond, Dynamic Targeting of Protein Phosphatase 1 within the Nuclei of Living Mammalian Cells, Journal of Cell Science, vol.114, issue.23, pp.4219-4247, 2001.

T. Ndam, A. Nicaise, T. Moussiliou, C. Lavstsen, A. T. Kamaliddin et al., Parasites Causing Cerebral Falciparum Malaria Bind Multiple Endothelial Receptors and Express EPCR and ICAM-1-Binding PfEMP1, Journal of Infectious Diseases, vol.215, issue.12, pp.1918-1943, 2017.

B. E. Turk, Understanding and Exploiting Substrate Recognition by Protein Kinases, Current Opinion in Chemical Biology, vol.12, issue.1, pp.4-10, 2008.

R. Tuteja, Malaria -An Overview, FEBS Journal, vol.274, issue.18, pp.4670-79, 2007.

A. M. Vaughan and S. Kappe, Plasmodium Liver Infection and Exoerythrocytic Biology, 2017.

S. Vembar, C. R. Sridhar, O. Macpherson, J. Y. Sismeiro, A. Coppée et al., The PfAlba1 RNA-Binding Protein Is an Important Regulator of Translational Timing in Plasmodium Falciparum Blood Stages, Genome Biology, vol.16, issue.1, pp.1-18, 2015.

,

I. Verbinnen, M. Ferreira, and M. Bollen, Biogenesis and Activity Regulation of Protein Phosphatase 1, Biochemical Society Transactions, vol.45, issue.1, pp.89-99, 2017.

J. C. Wagner, J. Randall, . Platt, J. Stephen, J. Goldfless et al., Efficient CRISPR/Cas9-Mediated Genome Editing in P. Falciparum, Nature Methods, vol.11, issue.9, pp.915-933, 2014.

P. Wakula, M. Beullens, H. Ceulemans, W. Stalmans, and M. Bollen, Degeneracy and Function of the Ubiquitous RVXF Motif That Mediates Binding to Protein Phosphatase-1, Journal of Biological Chemistry, vol.278, issue.21, pp.18817-18840, 2003.

,

R. F. Waller, B. Michael, A. F. Reed, G. I. Cowman, and . Mcfadden, Protein Trafficking To the Plastid of Plasmodium Falciparum Is via the Secretory Pathway, The EMBO Journal, vol.19, issue.8, pp.1794-1802, 2000.

R. Wampfler, N. E. Hofmann, S. Karl, I. Betuela, B. Kinboro et al., Effects of Liver-Stage Clearance by Primaquine on Gametocyte Carriage of Plasmodium Vivax and P. Falciparum, Plos Neglected Tropical Diseases, vol.11, issue.7, p.5753, 2017.

J. Wang, Q. Lv, X. Li, Y. Liu, K. Liu et al., Post-Transcriptional and Translational Regulation Modulates Gene Co-Expression Behavior in More Synchronized Pace to Carry out Molecular Function in the Cell, Gene, vol.587, issue.2, pp.163-68, 2016.

,

L. Wang, C. Delahunty, J. H. Prieto, S. Rahlfs, E. Jortzik et al., Protein S -Nitrosylation in Plasmodium Falciparum, Antioxidants & Redox Signaling, vol.20, issue.18, pp.2923-2958, 2014.

. Wang, E. M. Qi, L. M. Vogan, C. E. Nocka, J. A. Rosen et al., Autoinhibition of Bruton's Tyrosine Kinase (Btk) and Activation by Soluble Inositol Hexakisphosphate, ELife, vol.2015, issue.4, pp.1-31, 2015.

W. Wang, P. T. Stukenberg, and D. L. Brautigan, Phosphatase Inhibitor-2 Balances Protein Phosphatase 1 and Aurora B Kinase for Chromosome Segregation and Cytokinesis in Human Retinal Epithelial Cells, Molecular Biology of the Cell, vol.19, pp.4852-62, 2008.

,

G. E. Ward, M. Hisashi-fujioka, L. Aikawa, and . Miller, Staurosporine Inhibits Invasion of Erythrocytes by Malarial Merozoites, Experimental Parasitology, vol.79, pp.480-87, 1994.

P. Ward, L. Equinet, J. Packer, and C. Doerig, Protein Kinases of the Human Malaria Parasite Plasmodium Falciparum: The Kinome of a Divergent Eukaryote, BMC Genomics, vol.5, pp.1-19, 2004.
URL : https://hal.archives-ouvertes.fr/inserm-00103327

A. P. Waters, T. Higginst, and . Mccutchan, Plasmodium Falciparum Appears to Have Arisen as a Result of Lateral Transfer between Avian and Human Hosts, Proceedings of the National Academy of Sciences USA, vol.88, pp.3140-3184, 1991.

K. Weatherby and D. A. Carter, Chromera Velia. The Missing Link in the Evolution of Parasitism, Advances in Applied Microbiology. 1st ed, vol.85, 2013.

P. J. Weathers, M. Towler, A. Hassanali, P. Lutgen, and P. Engeu, Dried-Leaf Artemisia Annua : A Practical Malaria Therapeutic for Developing Countries?, World Journal of Pharmacology, vol.3, issue.4, pp.39-55, 2014.

G. E. Weiss, S. Brendan, P. R. Crabb, and . Gilson, Overlaying Molecular and Temporal Aspects of Malaria Parasite Invasion, Trends in Parasitology, vol.32, issue.4, pp.284-95, 2016.

M. T. White, S. Karl, C. Koepfli, R. J. Longley, N. E. Hofmann et al., Plasmodium Vivax and Plasmodium Falciparum Infection Dynamics: ReInfections, Recrudescences and Relapses, vol.17, pp.1-15, 2018.

. Who-vcag, Vector Control Advisory Group ( VCAG ) on New Tools , Technologies and Approaches -Terms of Reference 1, pp.1-7, 2017.

, WHO Guidelines for the Treatment of Malaria -3rd Edition, p.90261, 2015.

, Status Report on Artemisinin and ACT Resistance, vol.9, 2011.

, Artemisinin Resistance and Artemisinin-Based Combination Therapy Efficacy (Status Report, 2017c. WORLD MALARIA REPORT 2017. Licence CC BY-NC-SA 3.0 IGO, vol.13, 2017.

, Malaria Vaccine: WHO Position Paper, Vaccine, vol.36, issue.25, pp.3576-77, 2016.

J. M. Wilkes and C. Doerig, The Protein-Phosphatome of the Human Malaria Parasite Plasmodium Falciparum, BMC Genomics, vol.9, pp.1-19, 2008.

J. Williams, F. Njie, M. Cairns, K. Bojang, K. Sheick-oumar-coulibaly et al., Non-Falciparum Malaria Infections in Pregnant Women in West Africa, Malaria Journal, vol.15, issue.1, pp.1-8, 2016.

R. J. Wilson, ). Iain, P. W. Denny, P. R. Preiser, K. Rangachari et al., Complete Gene Map of the Plastid-like DNA of the Malaria Parasite Plasmodium Falciparum, Journal of Molecular Biology, vol.261, issue.2, pp.155-72, 1996.

,

. Witkowski, J. Benoit, M. Lelièvre, V. Barragán, . Laurent et al., Increased Tolerance to Artemisinin in Plasmodium Falciparum Is Mediated by a Quiescence Mechanism, Antimicrobial Agents and Chemotherapy, vol.54, issue.5, pp.1872-77, 2010.

M. H. Wright, B. Clough, D. Mark, K. Rackham, . Rangachari et al., Validation of N-Myristoyltransferase as an Antimalarial Drug Target Using an Integrated Chemical Biology Approach, Nature Chemistry, vol.6, pp.112-133, 2014.

Y. Xiong, J. D. Uys, K. D. Tew, and D. M. Townsend, S-Glutathionylation: From Molecular Mechanisms to Health Outcomes, Antioxidants & Redox Signaling, vol.15, issue.1, pp.233-70, 2011.

X. Xue, Q. Zhang, Y. Huang, L. Feng, and W. Pan, No MiRNA Were Found in Plasmodium and the Ones Identified in Erythrocytes Could Not Be Correlated with Infection, Malaria Journal, vol.7, pp.1-6, 2008.

M. Yagi, G. Bang, T. Tougan, M. Nirianne, N. Palacpac et al., Protective Epitopes of the Plasmodium Falciparum SERA5 Malaria Vaccine Reside in Intrinsically Unstructured N-Terminal Repetitive Sequences, PLoS ONE, vol.9, issue.6, pp.1-10, 2014.

. Yagi, . Masanori, M. Q. Nirianne, K. Palacpac, Y. Ito et al., Antibody Titres and Boosting after Natural Malaria Infection in BK-SE36 Vaccine Responders during a Follow-up Study in Uganda, Scientific Reports, vol.6, pp.2-9, 2016.

R. R. Yakubu, C. Natalie, E. Silmon-de-monerri, K. Nieves, L. M. Kim et al., Comparative Monomethylarginine Proteomics Suggests That Protein Arginine Methyltransferase 1 (PRMT1) Is a Significant Contributor to Arginine Monomethylation in Toxoplasma Gondii, Molecular & Cellular Proteomics, vol.16, issue.4, pp.567-80, 2017.

R. R. Yakubu, M. Louis, and N. C. Weiss, Posttranslational Modifications as Key Regulators of Apicomplexan Biology: Insights from Proteome-Wide Studies Rama, Molecular Microbiology, vol.107, issue.1, pp.1-23, 2018.

C. Yang and G. Arrizabalaga, The Serine/Threonine Phosphatases of Apicomplexan Parasites, Molecular Microbiology, vol.106, issue.1, pp.1-21, 2017.

E. Yeh and J. L. Derisi, Chemical Rescue of Malaria Parasites Lacking an Apicoplast Defines Organelle Function in Blood-Stage Plasmodium Falciparum, PLoS Biology, vol.9, issue.8, 2011.

,

E. Zeqiraj, M. F. Daan, and . Van-aalten, Pseudokinases-Remnants of Evolution or Key Allosteric Regulators?, Current Opinion in Structural Biology, vol.20, issue.6, pp.772-81, 2010.

,

H. Zhang, A. Photiou, A. Grothey, J. Stebbing, and G. Giamas, The Role of Pseudokinases in Cancer, Cellular Signalling, vol.24, issue.6, pp.1173-84, 2012.

,

M. Zhang, S. Mishra, R. Sakthivel, M. A. Beatriz, V. Fontoura et al., UIS2: A Unique Phosphatase Required for the Development of Plasmodium Liver Stages, PLoS Pathogens, vol.12, issue.1, pp.1-20, 2016.

M. Zhang, C. Wang, T. D. Otto, J. Oberstaller, X. Liao et al., Uncovering the Essential Genes of the Human Malaria Parasite Plasmodium Falciparum by Saturation Mutagenesis, Science, vol.360, issue.6388, 2018.

, , vol.226

|. :. , , pp.100-138

. |. ||,

. .. || and . ||, | PBANKA_094010 216 CESTSKSIGSDYISHFEKKEKQINKQEDELKKSKENYMNHSEYSNSSTNF, vol.265, pp.366-400

|. .. , , vol.457, pp.3-7

|. || and . ||,

|. .. , , vol.542, pp.3-7

|. |. , , pp.94010-531

|. :. ||,

, PBANKA_094010, vol.834, pp.LFSYLHCVKYKHIYVSKLLKYY-QKKFINQNFQQQNNTMSSDR

|. |. ,

|. |. ||-| and . ||,

. |. ||, LKNKISQKKINKKLNFKAK 1024 PF3D7_1106800 1209 IQMNQPYTFPPYQKELSSYLKNEKIKRKRKVLFSYLKTHIHFNSQQINDQ 1258 |::|:||.|||.|::.:.|| ||.|:|:|, pp.94010-1000

, Le programme a également rendu les résultats suivants : # Identité : 577/1593 (36.2%)

#. Similarité,

#. Gaps,

#. Score,