SAM DomainDependent Activity of PfTKL3, an Essential Tyrosine Kinase-like Kinase of the Human Malaria Parasite Plasmodium Falciparum, Cellular and Molecular Life Sciences, vol.67, pp.3355-69, 2010. ,
A Secreted Plasmodium Falciparum Kinase Reveals a Signature Motif for Classification of Tyrosine Kinase-like Kinases, Microbiology (United Kingdom), vol.159, pp.2533-2580, 2013. ,
,
An Essential Malaria Protein Defines the Architecture of Blood-Stage and Transmission-Stage Parasites, Nature Communications, vol.7, p.11449, 2016. ,
The Biology of Plasmodium Vivax, Cold Spring Harbor Perspectives in Medicine, vol.7, issue.9, pp.1-12, 2017. ,
The Revised Classification of Eukaryotes, J Eukaryot Microbiol, vol.59, issue.5, pp.429-93, 2012. ,
Erythrocyte Entry by Malarial Parasites, Journal of Cell Biology, vol.77, issue.1, pp.72-82, 1978. ,
The Red Blood Cell Proteome and Interactome : An Update, Journal of Proteome Research, vol.9, pp.144-63, 2010. ,
Plasmodium Falciparum AMA1 Binds a Rhoptry Neck Protein Homologous to TgRON4, a Component of the Moving Junction in Toxoplasma Gondii, Eukaryotic Cell, vol.5, issue.7, pp.1169-73, 2006. ,
Identification of the Moving Junction Complex of Toxoplasma Gondii: A Collaboration between Distinct Secretory Organelles, PLoS Pathogens, vol.1, issue.2, pp.137-186, 2005. ,
,
A Malarial Cysteine Protease Is Necessary for Plasmodium Sporozoite Egress from Oocysts, The Journal of Experimental Medicine, vol.202, issue.2, pp.225-255, 2005. ,
Diagnostic Tools in Childhood Malaria, Parasites and Vectors, vol.11, issue.1, pp.1-12, 2018. ,
Small Molecules Targeted to a NonCatalytic 'RVxF' Binding Site of Protein Phosphatase-1 Inhibit HIV-1, PLoS ONE, vol.7, issue.6, 2012. ,
,
A Genomic Perspective of Protein Kinases in Plasmadium Falciparum, Proteins: Structure, Function and Genetics, vol.58, issue.1, pp.180-89, 2005. ,
,
Cloning, Sequencing, and Expression of Equinatoxin II, Biochemical and Biophysical Research Communications, vol.220, issue.2, pp.437-479, 1996. ,
Antimalarial Drug Resistance: An Overview, Tropical Parasitology, vol.6, issue.1, p.30, 2016. ,
Two Dictyostelium Tyrosine Kinase-like Kinases Function in Parallel, Stress-Induced STAT Activation Pathways, Molecular Biology of the Cell, vol.25, pp.3222-3255, 1920. ,
Clues to Evolution of the SERA Multigene Family in 18 Plasmodium Species, PLoS ONE, vol.6, issue.3, p.17775, 2011. ,
Structural Analysis of Anopheles Midgut Aminopeptidase N Reveals a Novel Malaria Transmission-Blocking Vaccine B-Cell Epitope, Nat Struct Mol Biol, vol.22, issue.7, pp.532-571, 2015. ,
PlasmoDB: A Functional Genomic Database for Malaria Parasites, Nucleic Acids Research, vol.37, issue.1, pp.539-582, 2009. ,
The RNABinding SAM Domain of Smaug Defines a New Family of Post-Transcriptional Regulators, Nature Structural Biology, vol.10, issue.8, pp.614-635, 2003. ,
The Nonartemisinin Sesquiterpene Lactones Parthenin and Parthenolide Block Plasmodium Falciparum Sexual Stage Transmission, Antimicrobial Agents and Chemotherapy, vol.60, issue.4, pp.2108-2125, 2016. ,
Discovery of the Principal Specific Transcription Factors of Apicomplexa and Their Implication for the Evolution of the AP2-Integrase DNA Binding Domains, Nucleic Acids Research, vol.33, issue.13, pp.3994-4006, 2005. ,
,
The Ins, Outs and Roundabouts of Malaria, Trends in Parasitology, vol.19, issue.5, pp.86-88, 2003. ,
Effects of Aging on Parasite Biomass, Inflammation, Endothelial Activation, Microvascular Dysfunction and Disease Severity in Plasmodium Knowlesi and Plasmodium Falciparum Malaria, Journal of Infectious Diseases, vol.215, issue.12, pp.1908-1925, 2017. ,
World Malaria Report: Time to Acknowledge Plasmodium Knowlesi Malaria, Malaria Journal, vol.16, 2017. ,
Binding of the CTerminal Sterile ? Motif (SAM) Domain of Human P73 to Lipid Membranes, Journal of Biological Chemistry, vol.278, issue.47, pp.46878-85, 2003. ,
,
Molecular Genetics and Comparative Genomics Reveal RNAi Is Not Functional in Malaria Parasites, Nucleic Acids Research, vol.37, issue.11, pp.3788-98, 2009. ,
Genomics and Epigenetics of Sexual Commitment in Plasmodium, International Journal for Parasitology, vol.47, issue.7, pp.425-459, 2017. ,
,
Rhoptry Proteins ROP5 and ROP18 Are Major Murine Virulence Factors in Genetically Divergent South American Strains of Toxoplasma Gondii, PLoS Genetics, vol.11, issue.8, pp.1-22, 2015. ,
Current Vector Control Challenges in the Fight against Malaria, Acta Tropica, vol.174, pp.91-96, 2017. ,
The Development of Malaria Parasites in the Mosquito Midgut, Cellular Microbiology, vol.18, issue.7, pp.905-923, 2016. ,
Functional Analysis of Plasmodium Vivax VIR Proteins Reveals Different Subcellular Localizations and Cytoadherence to the ICAM-1 Endothelial Receptor, Cellular Microbiology, vol.14, issue.3, pp.386-400, 2012. ,
The Moving Junction of Apicomplexan Parasites: A Key Structure for Invasion, Cellular Microbiology, vol.13, issue.6, pp.797-805, 2011. ,
Plasmodium Falciparum Protein Phosphatase Type 1 Functionally Complements a Glc7 Mutant in Saccharomyces Cerevisiae, International Journal for Parasitology, vol.32, issue.6, pp.739-786, 2002. ,
, , pp.7-10
Altered Life History Strategies Protect Malaria Parasites against Drugs, Evolutionary Applications, vol.11, issue.4, pp.442-55, 2018. ,
A Genetic System to Study Plasmodium Falciparum Protein Function, Nature Methods, vol.14, issue.4, pp.450-56, 2017. ,
In Silico and Biological Survey of TranscriptionAssociated Proteins Implicated in the Transcriptional Machinery during the Erythrocytic Development of Plasmodium Falciparum, BMC Genomics, vol.11, p.34, 2010. ,
URL : https://hal.archives-ouvertes.fr/pasteur-00663529
Protein Phosphatase 1, a Plasmodium Falciparum Essential Enzyme, Is Exported to the Host Cell and Implicated in the Release of Infectious Merozoites, Cellular Microbiology, vol.8, issue.4, pp.591-601, 2006. ,
Odours of Plasmodium Falciparum-Infected Participants Influence Mosquito-Host Interactions, Scientific Reports, vol.7, issue.1, pp.1-9, 2017. ,
Detection and Prevention of Protein Aggregation before, during, and after Purification, Analytical Biochemistry, vol.316, issue.2, pp.59-68, 2003. ,
The Glycine-Rich Sequence of Protein Kinases: A Multifunctional Element, Trends in Biochemical Sciences, vol.19, issue.5, pp.90022-90023, 1994. ,
Identification of Novel Quinazoline Derivatives as Potent Antiplasmodial Agents, European Journal of Medicinal Chemistry, vol.161, pp.277-91, 2019. ,
,
Emerging Roles of Pseudokinases, Trends in Cell Biology, vol.16, issue.9, pp.443-52, 2006. ,
Protein Ser/ Thr Phosphatases -The Ugly Ducklings of Cell Signalling, FEBS Journal, vol.280, issue.2, pp.324-369, 2013. ,
The Role of Antimalarial Quality in the Emergence and Transmission of Resistance, Medical Hypotheses, vol.111, pp.49-54, 2017. ,
Essential CGMP Signaling in Toxoplasma Is Initiated by a Hybrid P-Type ATPase-Guanylate Cyclase, Cell Host & Microbe, vol.24, issue.6, pp.804-816, 2018. ,
The MRNA-Bound Proteome of the Human Malaria Parasite Plasmodium Falciparum, Genome Biology, vol.17, issue.1, pp.1-18, 2016. ,
Phylogenomics Reshuffles the Eukaryotic Supergroups, PLoS ONE, vol.2, issue.8, pp.1-6, 2007. ,
Phylogenomics Reveals a New 'megagroup' Including Most Photosynthetic Eukaryotes, Biology Letters, vol.4, issue.4, pp.366-69, 2008. ,
An Unusual TryptophanRich Domain Characterizes Two Secreted Antigens of Plasmodium Yoelii-Infected Erythrocytes, Molecular and Biochemical Parasitology, vol.110, issue.1, pp.252-260, 2000. ,
Functional Profiling of a Plasmodium Genome Reveals an Abundance of Essential Genes, Cell, vol.170, issue.2, pp.260-272, 2017. ,
Mechanisms of Plasmodium-Enhanced Attraction of Mosquito Vectors, Trends in Parasitology, vol.33, issue.12, pp.961-73, 2017. ,
The Role of Plasmodium Knowlesi in the History of Malaria Research, Parasitology, vol.145, issue.1, pp.6-17, 2016. ,
Regulated Oligomerisation and Molecular Interactions of the Early Gametocyte Protein Pfg27 in Plasmodium Falciparum Sexual Differentiation, International Journal for Parasitology, vol.40, issue.6, pp.663-73, 2010. ,
,
Bulletin Epidémiologique Hebdomadaire Hors-série, 2018. ,
Phylogenetic Analysis of Haemosporinid Parasites (Apicomplexa: Haemosporina) and Their Coevolution with Vectors and Intermediate Hosts, Archiv Fur Protistenkunde, vol.148, issue.3, p.80005, 1997. ,
The Ins and Outs of Phosphosignalling in Plasmodium: Parasite Regulation and Host Cell Manipulation, Molecular and Biochemical Parasitology, vol.208, issue.1, pp.2-15, 2016. ,
Alveolates, GBIF, 1991. ,
Investing in Malaria in Pregnancy in Sub-Saharan Africa, 2017. ,
Functional Diversity of Protein Phosphatase-1, a Cellular Economizer and Reset Button, Physiological Reviews, vol.84, issue.1, pp.1-39, 2004. ,
, A Tighter RVxF Motif Makes a Finer Sift, Chemistry and Biology, vol.13, issue.1, pp.6-8, 2006.
Regulator-Driven Functional Diversification of Protein Phosphatase-1 in Eukaryotic Evolution, BioEssays, vol.24, issue.4, pp.371-81, 2002. ,
The Anthropology of Malaria: Locating the Social, Medical Anthropology: Cross Cultural Studies in Health and Illness, vol.36, issue.5, pp.411-432, 2017. ,
,
Cryo-EM Insight into the Structure of MTOR Complex 1 and Its Interactions with Rheb and Substrates, F1000Research, vol.8, issue.14, pp.1-10, 2019. ,
,
Molecular Partitioning during Host Cell Penetration by Toxoplasma Gondii, Traffic, vol.5, issue.11, pp.855-67, 2004. ,
Development of a Peptide That Selectively Activates Protein Phosphatase-1 in Living Cells, Angewandte Chemie -International Edition, vol.51, issue.40, pp.10054-59, 2012. ,
Genomics and Evolution of Protein Phosphatases, Science Signaling, vol.10, issue.474, p.1796, 2017. ,
PfAlbas Constitute a New Eukaryotic DNA/RNA-Binding Protein Family in Malaria Parasites, Nucleic Acids Research, vol.40, issue.7, pp.3066-77, 2012. ,
Proteome-Wide Analysis Reveals Widespread Lysine Acetylation of Major Protein Complexes in 200, 2016. ,
, Scientific Reports, vol.6, pp.1-14, 2015.
Microbial Persistence and the Road to Drug Resistance, Cell Host and Microbe, vol.13, issue.6, pp.632-674, 2013. ,
Robust Inducible Cre Recombinase Activity in the Human Malaria Parasite Plasmodium Falciparum Enables Efficient Gene Deletion within a Single Asexual Erythrocytic Growth Cycle, Molecular Microbiology, vol.88, issue.4, pp.687-701, 2013. ,
The Plasmodium Falciparum Pseudoprotease SERA5 Regulates the Kinetics and Efficiency of Malaria Parasite Egress from Host Erythrocytes, PLoS Pathogens, vol.13, 2017. ,
Confident and Sensitive Phosphoproteomics Using Combinations of Collision Induced Dissociation and Electron Transfer Dissociation, Journal of Proteomics, vol.103, pp.1-14, 2014. ,
,
Plasmodium Malariae: Parasite and Disease, Clinical Microbiology Reviews, vol.20, issue.4, pp.579-92, 2007. ,
Biogenesis, Secretion, and Intercellular Interactions of Exosomes and Other Extracellular Vesicles, Annual Review of Cell and Developmental Biology, vol.30, issue.1, pp.255-89, 2014. ,
Malaria Epigenetics, Cold Spring Harbor Perspectives in Medicine, vol.7, issue.7, pp.1-23, 2017. ,
Comparative Genomics of Transcriptional Control in the Human Malaria Parasite Plasmodium Falciparum, Genome Research, vol.14, issue.8, pp.1548-54, 2004. ,
Sugar Activation and Glycosylation in Plasmodium, Malaria Journal, vol.14, issue.1, pp.1-10, 2015. ,
Malaria: Biology and Disease, Cell, vol.167, issue.3, pp.610-634, 2016. ,
History of Human Parasitology, Clinical Microbiology Reviews, vol.15, issue.4, pp.595-612, 2002. ,
History of the Discovery of the Malaria Parasites and Their Vectors, Parasites & Vectors, vol.3, issue.5, pp.1-9, 2010. ,
Malaria Immunity in Man and Mosquito: Insights into Unsolved Mysteries of a Deadly Infectious Disease, Annu Rev Immunol, vol.32, pp.157-87, 2014. ,
,
Brief History of the Clinical Diagnosis of Malaria: From Hippocrates to Osler, Journal of Vector Borne Diseases, vol.45, issue.3, pp.194-99, 2008. ,
Functional Insights into Pathogen Biology from 3D Electron Microscopy, FEMS Microbiology Reviews, vol.41, issue.6, pp.828-53, 2017. ,
Artemisia Annua Dried Leaf Tablets Treated Malaria Resistant to ACT and i.v. Artesunate: Case Reports, Phytomedicine, vol.32, pp.37-40, 2017. ,
,
Regulation of Protein Phosphatase Type 1 and Cell Cycle Progression by PfLRR1, a Novel Leucine-Rich Repeat Protein of the Human Malaria Parasite Plasmodium Falciparum, Molecular Microbiology, vol.60, issue.3, pp.578-90, 2006. ,
URL : https://hal.archives-ouvertes.fr/hal-00086327
How Long Do Rapid Diagnostic Tests Remain Positive after Anti-Malarial Treatment?, Malaria Journal, vol.17, issue.1, pp.1-13, 2018. ,
The Biology of Some Intraerythrocytic Parasites of Fishes, Amphibia and Reptiles, Advances in Parasitology, vol.45, issue.5, pp.45003-45010, 2000. ,
Repetitive Sequences in Malaria Parasite Proteins, FEMS Microbiology Reviews, vol.41, issue.6, pp.923-963, 2017. ,
Parasite Pathogenesis: The Dynamics of Chronic Malaria, Nature Microbiology, vol.2, pp.1-2, 2017. ,
Chemical Interrogation of Malarial Host and Parasite Kinomes, ChemBioChem, vol.15, issue.13, pp.1920-1950, 2014. ,
Why Do Malaria Parasites Increase Host Erythrocyte Permeability?, Trends in Parasitology, vol.30, issue.3, pp.151-59, 2014. ,
The Toxoplasma Gondii Inhibitor-2 Regulates Protein Phosphatase 1 Activity through Multiple Motifs, Parasitology Research, vol.116, issue.9, pp.2417-2443, 2017. ,
URL : https://hal.archives-ouvertes.fr/hal-02106427
Crystal Structure of Bacteriophage T4 5? Nuclease in Complex with a Branched DNA Reveals How Flap Endonuclease-1 Family Nucleases Bind Their Substrates, Journal of Biological Chemistry, vol.282, issue.43, pp.31713-31737, 2007. ,
On the Effects of Reactive Oxygen Species and Nitric Oxide on Red Blood Cell Deformability, Frontiers in Physiology, vol.9, p.332, 2018. ,
Current Challenges and Proposed Solutions to the Effective Implementation of the RTS, 2018. ,
, Malaria Vaccine Program in Sub-Saharan Africa: A Systematic Review, Plos One, vol.13, issue.12
Inhibition of Invasion and Intraerythrocytic Development of Plasmodium Falciparum by Kinase Inhibitors, Experientia, vol.52, issue.6, pp.621-644, 1996. ,
,
Protein Kinases as Targets for Antimalarial Intervention: Kinomics, Structure-Based Design, Transmission-Blockade, and Targeting Host Cell Enzymes, Biochimica et Biophysica Acta -Proteins and Proteomics, vol.1754, issue.1-2, pp.132-50, 2005. ,
Post-Translational Protein Modifications in Malaria Parasites, Nature Reviews Microbiology, vol.13, issue.3, pp.160-72, 2015. ,
The Algal Past and Parasite Present of the Apicoplast, Annual Review of Microbiology, vol.67, issue.1, pp.271-89, 2013. ,
Malaria Vaccines: Recent Advances and New Horizons, Cell Host and Microbe, vol.24, issue.1, pp.43-56, 2018. ,
Toxoplasma Actin Is Required for Efficient Host Cell Invasion, MBio, vol.6, issue.3, p.28, 2015. ,
Important Extracellular Interactions between Plasmodium Sporozoites and Host Cells Required for Infection, Trends in Parasitology, vol.xx, pp.1-11, 2018. ,
Epigenetic Variation and Regulation in Malaria Parasites, Annual Review of Microbiology, vol.72, issue.1, 2018. ,
,
Beyond Hemoglobin: Screening for Malaria Host Factors, Trends in Genetics, vol.34, issue.2, pp.133-174, 2018. ,
Structural Basis for the Recognition of Regulatory Subunits by the Catalytic Subunit of Protein Phosphatase 1 Specific Protein Phosphatases of Eukaryotic Cells (Stralfors Diverse Cellular Functions Including Glycogen Metabolism, The EMBO Journal Cohen, vol.16, issue.8, pp.1876-87, 1997. ,
, The Toxoplasma Pseudokinase ROP5 Forms Complexes with ROP18 and ROP17, 2014.
, Kinases That Synergize to Control Acute Virulence in Mice, Cell Host and Microbe, vol.15, issue.5, pp.537-50
Dawn of the Dead: Protein Pseudokinases Signal New Adventures in Cell Biology, Biochemical Society Transactions, vol.41, issue.4, pp.969-74, 2013. ,
,
MORN1 Has a Conserved Role in Asexual and Sexual Development across the Apicomplexa, Eukaryotic Cell, vol.7, issue.4, pp.698-711, 2008. ,
Transformation with Human Dihydrofolate Reductase Renders Malaria Parasites Insensitive to WR99210 but Does Not Affect the Intrinsic Activity of Proguanil, Proceedings of the National Academy of Sciences, vol.94, issue.20, pp.10931-10967, 1997. ,
Artefenomel (OZ439) plus Ferroquine, 2017. ,
Global Analysis of Apicomplexan Protein S-Acyl Transferases Reveals an Enzyme Essential for Invasion, Traffic, vol.14, issue.8, pp.895-911, 2013. ,
Plasmodium Falciparum Encodes a Conserved Active Inhibitor-2 for Protein Phosphatase Type 1: Perspectives for Novel Anti-Plasmodial Therapy, BMC Biology, vol.11, 2013. ,
Plasmodium Falciparum Inhibitor-3 Homolog Increases Protein Phosphatase Type 1 Activity and Is Essential for Parasitic Survival, Journal of Biological Chemistry, vol.287, issue.2, pp.1306-1327, 2012. ,
Identification of a Plasmodium Falciparum Inhibitor-2 Motif Involved in the Binding and Regulation Activity of Protein Phosphatase Type 1, FEBS Journal, vol.281, pp.4519-4553, 2014. ,
Budding of the Alveolate Alga Vitrella Brassicaformis Resembles Sexual and Asexual Processes in Apicomplexan Parasites, Protist, vol.168, issue.1, pp.80-91, 2017. ,
, Evidence of TRNA Cleavage in Apicomplexan Parasites: Half-TRNAs as New Potential Regulatory Molecules of Toxoplasma Gondii and Plasmodium Berghei, vol.188, pp.99-108, 2013.
,
Rupture and Release: A Role for Soluble Erythrocyte Content in the Pathology of Cerebral Malaria, p.33, 2017. ,
Paludisme et Maîtrise Des Populations Anophéliennes" 110, 1998. ,
ISP1-Anchored Polarization of GC?/CDC50A Complex Initiates Malaria Ookinete Gliding Motility, Current Biology, vol.28, issue.17, pp.2763-2776, 2018. ,
Dynamic Molecular Events Associated to Plasmodium Berghei Gametogenesis through Proteomic Approach, Journal of Proteomics, vol.180, pp.88-98, 2017. ,
URL : https://hal.archives-ouvertes.fr/hal-02126894
,
Genome Sequence of the Human Malaria Parasite Plasmodium Falciparum, Nature, vol.419, issue.6906, pp.498-511, 2002. ,
Innate Sensing of Malaria Parasites, Nature Reviews Immunology, vol.14, issue.11, pp.744-57, 2014. ,
,
Genome Editing in the Human Malaria Parasite Plasmodium Falciparum Using the CRISPR-Cas9 System, Nature Biotechnology, vol.32, issue.8, pp.819-840, 2014. ,
The Plasmodium Rhoptry Associated Protein Complex Is Important for Parasitophorous Vacuole Membrane Structure and Intraerythrocytic Parasite Growth, Cellular Microbiology, vol.19, issue.8, p.12733, 2017. ,
Identification and Stoichiometry of Glycosylphosphatidylinositol-Anchored Membrane Proteins of the Human Malaria Parasite Plasmodium Falciparum, Molecular & Cellular Proteomics, vol.5, issue.7, pp.1286-99, 2006. ,
,
The Prenylated Proteome of Plasmodium Falciparum Reveals Pathogen-Specific Prenylation Activity and Drug Mechanism-ofAction, Molecular & Cellular Proteomics, vol.16, pp.54-64, 2017. ,
,
Strengthening Regulatory Capacity for Gene Drives in Africa: Leveraging NEPAD's Experience in Establishing Regulatory Systems for Medicines and GM Crops in Africa, BMC Proceedings, vol.12, issue.8, 2018. ,
The Combinatorial PP1-Binding Consensus Motif (R/K)x(0,1)v/IxFxx(R/K)x(R/K) Is a New Apoptotic Signature, PLoS ONE, vol.5, issue.4, pp.1-8, 2010. ,
A Systematic Review of the Clinical Presentation, Treatment and Relapse Characteristics of Human Plasmodium Ovale Malaria, Malaria Journal, vol.16, issue.1, pp.1-16, 2017. ,
A MORN-Repeat Protein Is a Dynamic Component of the Toxoplasma Gondii Cell Division Apparatus, Journal of Cell Science, vol.119, issue.11, pp.2236-2281, 2006. ,
Use of Penetrating Peptides Interacting with PP1/PP2A Proteins As a General Approach for a Drug Phosphatase Technology, Molecular Pharmacology, vol.69, issue.4, pp.1115-1139, 2006. ,
URL : https://hal.archives-ouvertes.fr/pasteur-00189544
Efficient Invasion by Toxoplasma Depends on the Subversion of Host Protein Networks, Nature Microbiology, vol.2, issue.10, pp.1358-66, 2017. ,
A Sugar Phosphatase Regulates the Methylerythritol Phosphate (MEP) Pathway in Malaria Parasites, Nature Communications, vol.5, pp.1-10, 2014. ,
Epigenetic Landscapes Underlining Global Patterns of Gene Expression in the Human Malaria Parasite, Plasmodium Falciparum, International Journal for Parasitology, vol.47, issue.7, pp.399-407, 2017. ,
Genome-Wide Functional Analysis of Plasmodium Protein Phosphatases Reveals Key Regulators of Parasite Development and Differentiation, Cell Host and Microbe, vol.16, issue.1, pp.128-168, 2014. ,
Reductive Evolution of Chloroplasts in Non-Photosynthetic Plants, Algae and Protists, Current Genetics, vol.64, issue.2, pp.365-87, 2018. ,
Toxoplasma Effectors Targeting Host Signaling and Transcription, Clinical Microbiology Reviews, vol.30, issue.3, pp.615-660, 2017. ,
,
Drug Resistance in Plasmodium, Nature Reviews Microbiology, vol.16, issue.3, pp.156-70, 2018. ,
The Malaria Parasite Plasmodium Falciparum Sortilin Is Essential for Merozoite Formation and Apical Complex Biogenesis, Cellular Microbiology, 2018. ,
Screening a Protein Kinase Inhibitor Library against Plasmodium Falciparum, Malaria Journal, vol.16, issue.1, pp.1-11, 2017. ,
Extreme Mutation Bias and High AT Content in Plasmodium Falciparum, Nucleic Acids Research, vol.45, issue.4, pp.1889-1901, 2017. ,
URL : https://hal.archives-ouvertes.fr/hal-01989279
,
Genomic Analysis of the Eukaryotic Protein Kinase Superfamily: A Perspective, Genome Biology, vol.4, issue.5, p.111, 2003. ,
The Eukaryotic Protein Kinase Superfamily: Kinase (Catalytic) Domain Structure and Classification, FASEB, vol.9, pp.576-96, 1995. ,
The Protein Kinase Family : Conserved Protein Phylogeny Features and Deduced Phylogeny of the Catalytic Domains, Science, vol.241, issue.4861, pp.42-52, 1988. ,
Gene Splicing and Mutagenesis by PCR-Driven Overlap Extension, Nature Protocols, vol.2, issue.4, pp.924-956, 2007. ,
Bad Air, Amulets and Mosquitoes: 2,000 Years of Changing Perspectives on Malaria, Malaria Journal, vol.12, issue.1, 2013. ,
Docking Motif-Guided Mapping of the Interactome of Protein Phosphatase-1, Chemistry and Biology, vol.16, issue.4, pp.365-71, 2009. ,
,
Metals in the Active Site of Native Protein Phosphatase-1, Journal of Inorganic Biochemistry, vol.206, pp.1-5, 2015. ,
EBooks. The Internet Classics Archive ,
Palmitoylation and Palmitoyl-Transferases in Plasmodium Parasites, Biochemical Society Transactions, vol.43, issue.2, pp.240-285, 2015. ,
Analysis of the Interactome of the Ser/Thr Protein Phosphatase Type 1 in Plasmodium Falciparum, BMC Genomics, vol.17, issue.1, pp.1-16, 2016. ,
URL : https://hal.archives-ouvertes.fr/tel-01968039
Iliade Homère Chant 22 ,
Palmitoyl Transferases Have Critical Roles in the Development of Mosquito and Liver Stages of Plasmodium, Cellular Microbiology, vol.18, issue.11, pp.1625-1666, 2016. ,
Evidences of Protection against Blood-Stage Infection of Plasmodium Falciparum by the Novel Protein Vaccine SE36, Parasitology International, vol.59, issue.3, pp.380-86, 2010. ,
,
A Novel Polymer of Tubulin Forms the Conoid of Toxoplasma Gondii, The Journal of Cell Biology, vol.156, issue.6, pp.1039-50, 2002. ,
,
A Thousand and One Protein Kinases, Cell, vol.50, pp.823-852, 1987. ,
The Conformational Plasticity of Protein Kinases, Cell, vol.109, pp.741-750, 2002. ,
Artemisinin Resistance and Stage Dependency of Parasite Clearance in Falciparum Malaria, The Journal of Infectious Diseases, pp.1-7, 2019. ,
Cell-Passage Activity Is Required for the Malarial Parasite to Cross the Liver Sinusoidal Cell Layer, PLoS Biology, vol.2, issue.1, pp.77-84, 2004. ,
Identification of a Novel PostTranslational Modification in Plasmodium Falciparum: Protein Sumoylation in Different Cellular Compartments, Cellular Microbiology, vol.10, issue.10, pp.1999-2011, 2008. ,
The Trans-Golgi Network and the Golgi Stacks Behave Independently during Regeneration after Brefeldin A Treatment in Tobacco BY-2 Cells, Plant and Cell Physiology, vol.58, issue.4, pp.811-832, 2017. ,
Hot, Sweet and Sticky: The Glycobiology of Plasmodium Falciparum, Trends in Parasitology, vol.24, issue.5, pp.210-228, 2008. ,
, , p.207
Calcium-Dependent Phosphorylation of Plasmodium Falciparum Serine Repeat Antigen 5 Triggers Merozoite Egress, Journal of Biological Chemistry, vol.293, issue.25, pp.9736-9782, 2018. ,
Epigenetic Players of Chromatin Structure Regulation in Plasmodium Falciparum, 2019. ,
Contributions of Social Anthropology to Malaria Control, Encyclopedia of Infectious Diseases: Modern Metholologies, 2007. ,
A Common Red Algal Origin of the Apicomplexan, Dinoflagellate, and Heterokont Plastids, PNAS, vol.107, issue.24, pp.10949-54, 2010. ,
Plasmodium Berghei : General Parasitological Methods, 2004. ,
, High-Efficiency Transfection and Drug Selection of Genetically Transformed Blood Stages of the Rodent Malaria Parasite Plasmodium Berghei, Nature Protocols, vol.1, issue.1, pp.346-56, 2006.
Plasmodium Berghei: The Application of Cultivation and Purification Techniques to Molecular Studies of Malaria Parasites, Parasitology Today, vol.11, issue.4, pp.80133-80135, 1995. ,
The Rapid Generation of Mutation Data Matrices, vol.8, pp.275-82, 1992. ,
A Versatile Strategy for Rapid Conditional Genome Engineering Using LoxP Sites in a Small Synthetic Intron in Plasmodium Falciparum, Scientific Reports, vol.6, pp.1-9, 2015. ,
Generation of Transgenic Rodent Malaria Parasites by Transfection of Cell Culture-Derived Merozoites, Malaria Journal, vol.16, issue.1, p.305, 2017. ,
Rethinking Pseudokinases, Cell, vol.133, issue.2, pp.204-209, 2008. ,
Synthetic Peptides Derived from the C-Terminal 6 KDa Region of Plasmodium Falciparum SERA5 Inhibit the Enzyme Activity and Malaria Parasite Development, Biochimica et Biophysica Acta -General Subjects, vol.1840, issue.9, pp.2765-75, 2014. ,
,
Escherichia Coli Maltose-Binding Protein Is Uncommonly Effective at Promoting the Solubility of Polypeptides to Which It Is Fused, Protein Science, vol.8, issue.8, pp.1668-74, 1999. ,
Sniff and Tell: The Feasibility of Using Bio-Detection Dogs as a Mobile Diagnostic Intervention for Asymptomatic Malaria in Sub-Saharan Africa, Journal of Biosocial Science, pp.1-8, 2019. ,
Widespread Occurrence of Lysine Methylation in Plasmodium Falciparum Proteins at Asexual Blood Stages, Scientific Reports, vol.6, pp.1-24, 2016. ,
,
Protein S -Glutathionylation in Malaria Parasites, Antioxidants & Redox Signaling, vol.15, issue.11, pp.2855-65, 2011. ,
Inducible Developmental Reprogramming Redefines Commitment to Sexual Development in the Malaria Parasite Plasmodium Berghei, Nature Microbiology, vol.3, issue.11, pp.1206-1219, 2018. ,
How Does Toxoplama Gondii Invade Host Cells?, The Journal of Veterinary Medical Science, issue.122, pp.1702-1708, 2018. ,
Phosphatases, Encyclopedia of Malaria. Hommel M, 2013. ,
Phosphatases Are Emerging as Novel Druggable Targets in Plasmodium, Future Microbiology, vol.11, issue.5, pp.603-609, 2016. ,
Coordinated Loading of IRG Resistance GTPases on to the Toxoplasma Gondii Parasitophorous Vacuole, Cellular Microbiology, vol.12, issue.7, pp.939-61, 2010. ,
SAM Domains: Uniform Structure, Diversity of Function, Trends in Biochemical Sciences, vol.28, issue.12, pp.625-653, 2003. ,
The Rhoptry Pseudokinase ROP54 Modulates Toxoplasma Gondii Virulence and Host GBP2 Loading, MSphere, vol.1, issue.2, pp.1-15, 2016. ,
,
Insects and Disease -Mosquitoes and Malaria, 1883. ,
Membrane Transport in the Malaria Parasite and Its Host Erythrocyte, Biochemical Journal, vol.457, issue.1, pp.1-18, 2014. ,
Metal Coordination in Kinases and Pseudokinases, Biochemical Society Transactions, vol.45, issue.3, pp.653-63, 2017. ,
Substrate Specificity of Protein Kinases and Computational Prediction of Substrates, Biochimica et Biophysica Acta -Proteins and Proteomics, vol.1754, issue.1-2, pp.200-209, 2005. ,
,
Plasmodium Species: Master Renovators of Their Host Cells, Nature Reviews Microbiology, vol.14, issue.8, pp.494-507, 2016. ,
, , p.209
Pellicle Formation in the Malaria Parasite, Journal of Cell Science, vol.129, issue.4, pp.673-80, 2016. ,
Surface Comparison of Active and Inactive Protein Kinases Identifies a Conserved Activation Mechanism, Proceedings of the National Academy of Sciences, vol.103, issue.47, pp.17783-88, 2006. ,
Defining the Conserved Internal Architecture of a Protein Kinase, Biochimica et Biophysica Acta -Proteins and Proteomics, vol.1804, issue.3, pp.440-484, 2010. ,
The Ki-67 and RepoMan Mitotic Phosphatases Assemble via an Identical, yet Novel Mechanism, ELife, vol.5, pp.1-15, 2016. ,
Characterisation and Expression of a PP1 Serine/Threonine Proteinphosphatase (PfPP1) from the Malaria Parasite, Plasmodium Falciparum:Demonstration of Its Essential Role Using RNA Interference, Malaria Journal, vol.1, pp.1-11, 2002. ,
Inner Membrane Complex 1l Protein of Plasmodium Falciparum Links Membrane Lipids with Cytoskeletal Element 'Actin' and Its Associated Motor 'Myosin, International Journal of Biological Macromolecules, vol.126, pp.673-84, 2019. ,
Evolution of Genome Organization and Epigenetic Machineries, Journal of Biosciences, vol.43, issue.2, pp.239-281, 2018. ,
Identification of O-GlcNAcylated Proteins in Plasmodium Falciparum, Malaria Journal, vol.16, issue.1, pp.1-11, 2017. ,
Saccharomyces Cerevisiae Ste50 Binds the MAPKKK Ste11 through a Head-to-Tail SAM Domain Interaction, Journal of Molecular Biology, vol.356, issue.1, pp.142-54, 2006. ,
, Medecine Sciences : M/S, vol.24, issue.4, pp.399-405, 2008.
The Rate of Hydrolysis of Phosphomonoester Dianions and the Exceptional Catalytic Proficiencies of Protein and Inositol Phosphatases, Proceedings of the National Academy of Sciences, vol.100, issue.10, pp.5607-5617, 2003. ,
The RON2-AMA1 Interaction Is a Critical Step in Moving Junction-Dependent Invasion by Apicomplexan Parasites, PLoS Pathogens, vol.7, issue.2, 2011. ,
Plasticity and Redundancy among AMA-RON Pairs Ensure Host Cell Entry of Toxoplasma Parasites, Nature Communications, vol.5, pp.1-13, 2014. ,
Methods to Investigate the Regulatory Role of Small RNAs and Ribosomal Occupancy of Plasmodium Falciparum, Journal of Visualized Experiments : JoVE, issue.106, 2015. ,
The RIO Kinases: An Atypical Protein Kinase Family Required for Ribosome Biogenesis and Cell Cycle Progression, Biochimica et Biophysica ActaProteins and Proteomics, vol.1754, issue.1-2, pp.14-24, 2005. ,
Extensive Differential Protein Phosphorylation as Intraerythrocytic Plasmodium Falciparum Schizonts Develop into Extracellular Invasive Merozoites, Proteomics, vol.15, issue.15, pp.2716-2745, 2015. ,
Insights into the Plasmodium Falciparum Schizont Phospho-Proteome, Microbes and Infection, vol.14, issue.10, pp.811-830, 2012. ,
Vacuolar Uptake of Host Components, and a Role for Cholesterol and Sphingomyelin in Malarial Infection, Narla Mohandas, and Kasturi Haldar, vol.19, pp.3556-64, 2000. ,
Nature Parasitaire Des Accidents de l'impaludisme. BnF Gallica, 1881. ,
Dimerization of the Pragmin Pseudo-Kinase Regulates Protein Tyrosine Phosphorylation, Structure, vol.26, issue.4, pp.545-554, 2018. ,
URL : https://hal.archives-ouvertes.fr/hal-01872982
Characterization of a Protein Phosphatase Type-1 and a Kinase Anchoring Protein in Plasmodium Falciparum, Frontiers in Microbiology, vol.9, p.2617, 2018. ,
Caspase Cleavages of the Lymphocyte-Oriented Kinase Prevent Ezrin, Radixin, and Moesin Phosphorylation during Apoptosis, Journal of Biological Chemistry, vol.291, pp.10148-61, 2016. ,
Progress in Taxonomy of the Apicomplexan Protozoa, The Journal of Protozoology, vol.35, issue.4, pp.518-538, 1988. ,
Differential Localization of Processed Fragments of Plasmodium Falciparum Serine Repeat Antigen and Further Processing of Its N-Terminal 47 KDa Fragment, Parasitology International, vol.51, issue.4, pp.42-51, 2002. ,
The Actin Cytoskeleton, 2000. ,
Evolution of the Intron-Exon Structure of Eukaryotic Genes, Current Opinion in Genetics and Development, vol.5, issue.6, pp.774-78, 1995. ,
, , pp.80010-80013
Protein O-Fucosylation in Plasmodium Falciparum Ensures Efficient Infection of Mosquito and Vertebrate Hosts, Nature Communications, vol.8, issue.1, 2017. ,
,
Targeted Proteomic Dissection of Toxoplasma Cytoskeleton Sub-Compartments Using MORN1, Cytoskeleton (Hoboken), vol.69, issue.12, pp.1069-85, 2012. ,
A Toxoplasma MORN1 Null Mutant Undergoes Repeated Divisions but Is Defective in Basal Assembly, Apicoplast Division and Cytokinesis, PLoS ONE, vol.5, issue.8, 2010. ,
Malaria Elimination: Time to Target All Species, American Journal of Tropical Medicine and Hygiene, vol.99, issue.1, pp.17-23, 2018. ,
Exploiting the Apicoplast: ApicoplastTargeting Drugs and Malaria Vaccine Development, Microbes and Infection, vol.20, issue.9, pp.477-83, 2018. ,
A Redesigned CRISPR/Cas9 System for Marker-Free Genome Editing in Plasmodium Falciparum, Parasites & Vectors, vol.9, 0198. ,
Nascent RNA Sequencing Reveals Mechanisms of Gene Regulation in the Human Malaria Parasite Plasmodium Falciparum, Nucleic Acids Research, vol.45, issue.13, pp.7825-7865, 2017. ,
Techniques to Examine Nucleotide Binding by Pseudokinases: Table 1, Biochemical Society Transactions, vol.41, issue.4, pp.975-80, 2013. ,
Alternative Splicing Mechanisms Orchestrating Post-Transcriptional Gene Expression: Intron Retention and the Intron-Rich Genome of Apicomplexan Parasites, Current Genetics, vol.62, issue.1, pp.31-38, 2016. ,
Structure of the Pseudokinase-Kinase Domains from Protein Kinase TYK2 Reveals a Mechanism for Janus Kinase (JAK) Autoinhibition, Proceedings of the National Academy of Sciences, vol.111, issue.22, pp.8025-8055, 2014. ,
Cerebral Malaria, Brain Research Bulletin, 2019. ,
MORN Motifs in Plant PIPKs Are Involved in the Regulation of Subcellular Localization and Phospholipid Binding, Cell Research, vol.16, issue.5, pp.466-78, 2006. ,
Universal Features of Post-Transcriptional Gene Regulation Are Critical for Plasmodium Zygote Development, PLoS Pathogens, vol.6, issue.2, 2010. ,
, AnAPN1 Antigen in Transmission-Blocking Vaccines, Fact Sheet, vol.2
The Protein Kinase Complement of the Human Genome, Science, p.298, 2000. ,
Dormancy in Mammalian Malaria, Trends in Parasitology, vol.28, issue.2, pp.39-45, 2012. ,
Evolutionary Analysis of Arabidopsis, Cyanobacterial, and Chloroplast Genomes Reveals Plastid Phylogeny and Thousands of Cyanobacterial Genes in the Nucleus, PNAS, vol.99, pp.1-6, 2002. ,
Modulation of Host Cell SUMOylation Facilitates Efficient Development of Plasmodium Berghei and Toxoplasma Gondii, Cellular Microbiology, vol.19, issue.7, pp.1-13, 2017. ,
Tackling Resistance: Emerging Antimalarials and New Parasite Targets in the Era of Elimination, F1000Research, vol.7, issue.0, p.1170, 2018. ,
Checks and Balances? DNA Replication and the Cell Cycle in Plasmodium, Parasites and Vectors, vol.11, issue.1, pp.1-13, 2018. ,
Illuminating How Malaria Parasites Export Proteins into Host Erythrocytes, Cellular Microbiology, 2019. ,
Plasmodium: More Don'ts, Trends in Parasitology, vol.35, issue.1, pp.4-6, 2018. ,
The Apicoplast: Now You See It, Now You Don't, International Journal for Parasitology, vol.47, issue.2-3, pp.137-181, 2017. ,
The Biology of Malaria Transmission, Recent Advances in Malaria, vol.7, pp.87-124, 2017. ,
Host Erythrocyte Environment Influences the Localization of Exported Protein 2, an Essential Component of the Plasmodium Translocon, Eukaryotic Cell, vol.14, issue.4, pp.371-84, 2015. ,
Structural Analysis of the Protein Phosphatase 1 Docking Motif: Molecular Description of Binding Specificities Identifies Interacting Proteins, Chemistry and Biology, vol.13, issue.1, pp.49-59, 2006. ,
Looking under the Skin: The First Steps in Malarial Infection and Immunity, Nature Reviews Microbiology, vol.11, issue.10, pp.701-713, 2013. ,
Artemisinin: Mechanisms of Action, Resistance and Toxicity, International Journal for Parasitology, vol.32, pp.194-201, 2002. ,
The Pathogenic Basis of Malaria, vol.415, pp.673-79, 2002. ,
A Subset of Plasmodium Falciparum SERA Genes Are Expressed and Appear to Play an Important Role in the Erythrocytic Cycle, Journal of Biological Chemistry, vol.277, issue.49, pp.47524-47556, 2002. ,
Malaria Pathogenesis, Cold Spring Harbor Perspectives in Medicine, vol.8, issue.1, 2018. ,
Replication and Maintenance of the Plasmodium Falciparum Apicoplast Genome, Molecular and Biochemical Parasitology, vol.208, issue.2, pp.56-64, 2016. ,
Crystal Structure of the Kinase Domain of WNK1, a Kinase That Causes a Hereditary Form of Hypertension, Structure, vol.12, issue.7, pp.1303-1314, 2004. ,
Applying Chemical Genetic Tools to the Study of Phospho-Signalling Pathways in Malaria Parasites, Biochimica et Biophysica Acta -Proteins and Proteomics, vol.1854, issue.10, pp.1650-56, 2015. ,
The ABC of Protein Kinase Conformations, Biochimica et Biophysica Acta -Proteins and Proteomics, vol.1854, issue.10, pp.1555-66, 2015. ,
A Knockout Screen of ApiAP2 Genes Reveals Networks of Interacting Transcriptional Regulators Controlling the Plasmodium Life Cycle, Cell Host & Microbe, vol.21, issue.1, pp.11-22, 2017. ,
Measuring and Characterizing Night Time Human Behaviour as It Relates to Residual Malaria Transmission in SubSaharan Africa: A Review of the Published Literature, Malaria Journal, vol.18, issue.1, 2019. ,
A Photosynthetic Alveolate Closely Related to Apicomplexan Parasites, Nature, vol.451, issue.7181, pp.959-63, 2008. ,
First-in-Human, Randomized, Double-Blind Clinical Trial of Differentially Adjuvanted PAMVAC, a Vaccine Candidate to Prevent Pregnancy-Associated Malaria, Clinical Infectious Diseases, 2019. ,
Proteins on the Basis of Their Membrane Anchoring, J. Exp. Med, vol.190, issue.12, pp.1783-92, 1999. ,
Principles of CDK Regulation, Nature, vol.374, issue.6518, pp.131-165, 1995. ,
PV1, a Novel Plasmodium Falciparum Merozoite Dense Granule Protein, Interacts with Exported Protein in Infected Erythrocytes, Scientific Reports, vol.8, issue.1, pp.1-11, 2018. ,
,
Cytoskeleton of Apicomplexan Parasites, MICROBIOLOGY AND MOLECULAR BIOLOGY REVIEWS, vol.66, issue.1, pp.21-38, 2002. ,
,
Crystal Structure of ARF1?Sec7 Complexed with Brefeldin A and Its Implications for the Guanine Nucleotide Exchange Mechanism, Molecular Cell, vol.12, issue.6, pp.475-476, 2003. ,
Protein Phosphatase 1 Inactivates Mps1 to Ensure Efficient Spindle Assembly Checkpoint Silencing, ELife, vol.6, pp.1-29, 2017. ,
CASK Functions as a Mg2+-Independent Neurexin Kinase, Cell, vol.133, issue.2, pp.328-367, 2008. ,
Maurer's Clefts, the Enigma of Plasmodium Falciparum, Proceedings of the National Academy of Sciences, vol.110, issue.50, pp.19987-94, 2013. ,
The Role of Protein Phosphatase-1 in the Modulation of Synaptic and Structural Plasticity, FEBS Letters, vol.567, issue.1, pp.121-149, 2004. ,
A Robust Methodology to Subclassify Pseudokinases Based on Their Nucleotide-Binding Properties, Biochemical Journal, vol.457, issue.2, pp.323-357, 2014. ,
,
Aurora B Opposes PP1 Function in Mitosis by Phosphorylating the Conserved PP1-Binding RVxF Motif in PP1 Regulatory Proteins, Science Signaling, vol.11, issue.530, 2018. ,
Some Observations Which Appear to Establish the Aërial Transportation of Malarial Germs, Transactions of the American Climatological Association for the Year ... American Climatological Association, vol.11, pp.91-111 ,
The Host Specificity of Ape Malaria Parasites Can Be Broken in Confined Environments, International Journal for Parasitology, vol.46, issue.11, pp.737-781, 2016. ,
URL : https://hal.archives-ouvertes.fr/hal-01957730
UBE2O Remodels the Proteome during Terminal Erythroid Differentiation, Science, vol.357, issue.6350, pp.1-22, 2017. ,
Plasmodium Gametocytes Display Homing and Vascular Transmigration in the Host Bone Marrow, Science Advances, vol.4, issue.5, pp.1-16, 2018. ,
,
Regulation of Protein Kinases: Controlling Activity through Activation Segment Conformation, Molecular Cell, vol.15, issue.5, pp.661-75, 2004. ,
,
Plasmodium Falciparum Fikk Kinase Members Target Distinct Components of the Erythrocyte Membrane, PLoS ONE, vol.5, issue.7, pp.1-8, 2010. ,
Morphology, Ultrastructure and Life Cycle of Vitrella Brassicaformis n. Sp., n. Gen., a Novel Chromerid from the Great Barrier Reef, Protist, vol.163, issue.2, pp.306-329, 2012. ,
Composition of Anopheles Mosquitoes, Their BloodMeal Hosts, and Plasmodium Falciparum Infection Rates in Three Islands with Disparate Bed Net Coverage in Lake Victoria, Kenya, Malaria Journal, vol.16, issue.1, pp.1-12, 2017. ,
Phase 1b Randomized Trial and Follow-Up Study in Uganda of the Blood-Stage Malaria Vaccine Candidate BK-SE36, PLoS ONE, vol.8, issue.5, 2013. ,
,
Plasmodium Falciparum Serine Repeat Antigen 5 (SE36) as a Malaria Vaccine Candidate, Vaccine, vol.29, issue.35, pp.5837-5882, 2011. ,
Endoperoxide-Based Compounds: Cross-Resistance with Artemisinins and Selection of a Plasmodium Falciparum Lineage with a K13 Non-Synonymous Polymorphism, Journal of Antimicrobial Chemotherapy, pp.395-403, 2017. ,
URL : https://hal.archives-ouvertes.fr/hal-01963522
,
Genome Wide in Silico Analysis of Plasmodium Falciparum Phosphatome, BMC Genomics, vol.15, issue.1, pp.1-22, 2014. ,
Complement-Mediated Killing of Plasmodium Falciparum Erythrocytic Schizont with Antibodies to the Recombinant Serine Repeat Antigen (SERA), Vaccine, vol.16, issue.13, pp.57-64, 1998. ,
Antibodies Reactive with the N-Terminal Domain of Plasmodium Falciparum Serine Repeat Antigen Inhibit Cell Proliferation by Agglutinating Merozoites and Schizonts, Infection and Immunity, vol.67, issue.4, pp.1821-1848, 1999. ,
Presumed Pseudokinase VRK3 Functions as a BAF Kinase, Biochimica et Biophysica Acta (BBA) -Molecular Cell Research, vol.1853, issue.7, pp.1738-1786, 2015. ,
A Novel Pfs38 Protein Complex on the Surface of Plasmodium Falciparum Blood-Stage Merozoites, Malaria Journal, vol.16, issue.1, pp.1-15, 2017. ,
The Glycosylphosphatidylinositol Anchor : A Complex Membrane-Anchoring, BIochemistry, vol.47, pp.6991-7000, 2008. ,
Global Analysis of Protein Expression and Phosphorylation of Three Stages of Plasmodium Falciparum Intraerythrocytic Development, Journal of Proteome Research, vol.12, issue.9, pp.4028-4073, 2013. ,
Integrative Genomic Approaches Highlight a Family of Parasite-Specific Kinases That Regulate Host Responses, Cell Host & Microbe, vol.8, issue.2, pp.208-226, 2010. ,
A QM/MM Study of the Associative Mechanism for the Phosphorylation Reaction Catalyzed by Protein Kinase A and Its D166A Mutant, Journal of Computer-Aided Molecular Design, vol.28, issue.11, pp.1077-91, 2014. ,
Parasites and Human Evolution, Evolutionary Anthropology, vol.23, issue.6, pp.218-246, 2014. ,
A Propos de La Découverte de l'hématozoaire Du Paludisme Par A. Laveran Bône 1878 -Constantine 1880*, Histoire Des Sciences Medicales, vol.1, p.57, 1995. ,
Conditional Degradation of Plasmodium Calcineurin Reveals Functions in Parasite Colonization of Both Host and Vector, Cell Host and Microbe, vol.18, issue.1, pp.122-153, 2015. ,
Malaria, Nature Reviews -Disease Primers, vol.3, 2017. ,
Inhibition of Protein-Protein Interactions in Plasmodium Falciparum: Future Drug Targets, Current Pharmaceutical Design, vol.18, issue.24, pp.3522-3552, 2012. ,
Peptides Derived from <em>Plasmodium Falciparum</Em> Leucine-Rich Repeat 1 Bind to Serine/Threonine Phosphatase Type 1 and Inhibit Parasite Growth in Vitro, Drug Design, Development and Therapy, vol.12, pp.85-88, 2018. ,
Assistance of Maltose Binding Protein to the in Vivo Folding of the Disulfide-Rich C-Terminal Fragment from Plasmodium Falciparum Merozoite Surface Protein 1 Expressed in Escherichia Coli, Biochemistry, vol.42, issue.45, pp.13202-13213, 2003. ,
URL : https://hal.archives-ouvertes.fr/pasteur-00364798
Functional Characterization of a SUMO Deconjugating Protease of Plasmodium Falciparum Using Newly Identified Small Molecule Inhibitors, Chem Biol, vol.18, issue.6, pp.711-732, 2011. ,
SAM: A Novel Motif in Yeast Sterile and Drosophila Polyhomeotic, Molecular And General Genetics, pp.1928-1958, 1995. ,
Unraveling the Ubiquitome of the Human Malaria Parasite, The Journal of Biological Chemistry, vol.286, pp.40320-40350, 2011. ,
,
Single-Cell RNA-Seq Reveals a Signature of Sexual Commitment in Malaria Parasites, Nature, vol.551, issue.7678, pp.95-99, 2017. ,
Malaria Sporozoites Actively Enter and Pass through Rat Kupffer Cells Prior to Hepatocyte Invasion, Hepatology, vol.33, issue.5, pp.1154-65, 2001. ,
,
Inducible Knockdown of Plasmodium Gene Expression Using the GlmS Ribozyme, PLoS ONE, vol.8, issue.8, pp.1-10, 2013. ,
Trafficking of STEVOR to the Maurer's Clefts in Plasmodium Falciparum-Infected Erythrocytes, EMBO Journal, vol.24, issue.13, pp.2306-2323, 2005. ,
,
Ticket to Ride: Export of Proteins to the Plasmodium Falciparum-Infected Erythrocyte, Molecular Microbiology, vol.101, issue.1, pp.1-11, 2016. ,
Mutations in the Plasmodium Falciparum Chloroquine Resistance Transporter, PfCRT, Enlarge the Parasite's Food Vacuole and Alter Drug Sensitivities, Scientific Reports, vol.5, pp.1-16, 2015. ,
The Plasmodium Serine-Type SERA Proteases Display Distinct Expression Patterns and Non-Essential in Vivo Roles during Life Cycle Progression of the Malaria Parasite, Cellular Microbiology, vol.12, issue.6, pp.725-764, 2010. ,
The Many Faces of SAM, Science's STKE, vol.123, issue.6, pp.993-99, 2005. ,
Spinophilin Directs Protein Phosphatase 1 Specificity by Blocking Substrate Binding Sites, Nature Structural Molecular Biology, vol.17, issue.4, pp.459-64, 2010. ,
Metabolic Maps and Functions of the Plasmodium Falciparum Apicoplast, Nature Reviews Microbiology, vol.2, issue.3, pp.203-219, 2004. ,
SAM Domains Can Utilize Similar Surfaces for the Formation of Polymers and Closed Oligomers, Journal of Molecular Biology, vol.342, issue.5, pp.1353-58, 2004. ,
Protein Phosphatase 1 Is a Key Player in Nuclear Events, Cellular Signalling, vol.27, issue.12, pp.2589-98, 2015. ,
, , p.218
A Bioinformatic Survey of RNA-Binding Proteins in Plasmodium, BMC Genomics, vol.16, issue.1, pp.1-26, 2015. ,
A Conserved Non-Canonical Motif in the Pseudoactive Site of the ROP5 Pseudokinase Domain Mediates Its Effect on Toxoplasma Virulence, Journal of Biological Chemistry, vol.286, issue.33, pp.29366-75, 2011. ,
Virulence without Catalysis: How Can a Pseudokinase Affect Host Cell Signaling?, Trends in Parasitology, vol.28, issue.2, pp.53-57, 2012. ,
The Toxoplasma Pseudokinase ROP5 Is an Allosteric Inhibitor of the Immunity-Related GTPases, Journal of Biological Chemistry, vol.289, issue.40, pp.27849-58, 2014. ,
Single-Cell RNASeq Reveals Hidden Transcriptional Variation in Malaria Parasites, ELife, vol.7, pp.1-29, 2018. ,
Trafficking and Signaling by Fatty-Acylated and Prenylated Proteins, Nature Chemical Biology, vol.2, issue.11, pp.584-90, 2006. ,
Clinical Implications of a Gradual Dormancy Concept in Malaria, Parasitology Research, vol.115, issue.6, pp.2139-2187, 2016. ,
Malaria Sporozoites Traverse Host Cells within Transient Vacuoles, Cell Host and Microbe, vol.18, issue.5, pp.593-603, 2015. ,
URL : https://hal.archives-ouvertes.fr/hal-01226222
Malaria Parasites Distribute Subversive Messages across Enemy Lines, Trends in Parasitology, vol.33, issue.1, pp.2-4, 2017. ,
,
Drug-Resistant Malaria Advances in Mekong, Science Mag, vol.358, issue.6360, pp.155-56, 2017. ,
Malaria in Pregnancy: Pathogenesis and Immunity, Lancet Infectious Diseases, vol.7, pp.105-116, 2007. ,
, , pp.70022-70023
Report on the Cultivation of Proteosoma, Labbé, in Grey Mosquito -Concluded from Page 408, The Indian Medical Gazette, 1898. ,
Efficacy and Safety of RTS,S/AS01 Malaria Vaccine with or without a Booster Dose in Infants and Children in Africa: Final Results of a Phase 3, Individually Randomised, Controlled Trial, The Lancet, vol.386, issue.9988, pp.60721-60729, 2015. ,
Malaria and Its Influence on World Health, 1943. ,
Malaria Infection and Human Evolution, Le Infezioni in Medicina, vol.1, pp.56-74, 2010. ,
, Paludisme Grave. ARNETTE GR, 2001.
The Role of Extracellular Vesicles in Malaria Biology and Pathogenesis, Malaria Journal, vol.16, issue.1, pp.1-11, 2017. ,
The Role of Cholesterol and Glycosylphosphatidylinositol-Anchored Proteins of Erythrocyte Rafts in Regulating Raft Protein Content and Malarial Infection, Journal of Biological Chemistry, vol.276, issue.31, pp.29319-29348, 2001. ,
Structure of the Pseudokinase VRK3 Reveals a Degraded Catalytic Site, a Highly Conserved Kinase Fold, and a Putative Regulatory Binding Site, Structure, vol.17, issue.1, pp.128-166, 1993. ,
Brain Swelling and Death in Children with Cerebral Malaria, New England Journal of Medicine, vol.372, issue.12, pp.1126-1163, 2015. ,
Structure of a Gametocyte Protein Essential for Sexual Development in Plasmodium Falciparum, Nature Structural Biology, vol.10, issue.3, pp.197-203, 2003. ,
Relict Plastidic Metabolic Process as a Potential Therapeutic Target, Drug Discovery Today, vol.23, issue.1, pp.134-174, 2018. ,
Key Molecular Events during Host Cell Invasion by Apicomplexan Pathogens, Current Opinion in Microbiology, vol.16, issue.4, pp.432-469, 2013. ,
,
Kinases and Pseudokinases: Lessons from RAF, Molecular and Cellular Biology, vol.34, issue.9, pp.1538-1584, 2014. ,
, Fatty Acid Metabolism in the Plasmodium Apicoplast: Drugs, Doubts and Knockouts, vol.199, pp.34-50, 2015.
ErbB3/HER3 Intracellular Domain Is Competent to Bind ATP and Catalyze Autophosphorylation, Proceedings of the National Academy of Sciences, vol.107, issue.17, pp.7692-97, 2010. ,
,
Invasion and Intracellular Survival by Protozoan Parasites, Immunological Reviews, vol.240, issue.1, pp.72-91, 2011. ,
Activation of a PAK-MEK Signalling Pathway in Malaria Parasite-Infected Erythrocytes, Cellular Microbiology, vol.13, issue.6, pp.836-881, 2011. ,
Kidney Involvement in Malaria: An Update, pp.1-6, 2016. ,
Molecular Mechanisms of Protein Kinase Regulation by Calcium/Calmodulin, Bioorganic and Medicinal Chemistry, vol.23, issue.12, pp.2749-60, 2015. ,
A Cascade of DNA Binding Proteins for Sexual Commitment and Development in Plasmodium, Nature, vol.507, issue.7491, pp.253-57, 2014. ,
,
Molecular Profiling of Phagocytic Immune Cells in Anopheles Gambiae Reveals Integral Roles for Hemocytes in Mosquito Innate Immunity, Molecular & Cellular Proteomics, vol.15, issue.11, pp.3373-87, 2016. ,
Insights into Cytochrome Bc1 Complex Binding Mode of Antimalarial 2-Hydroxy-1,4-Naphthoquinones through Molecular Modelling, Memorias Do Instituto Oswaldo Cruz, vol.112, issue.4, pp.299-308, 2017. ,
Molecular and Functional Aspects of Parasite Invasion, Trends in Parasitology, vol.20, issue.12, 2004. ,
Malaria Proteases Mediate Inside-out Egress of Gametocytes from Red Blood Cells Following Parasite Transmission to the Mosquito, Cellular Microbiology, vol.13, issue.6, pp.897-912, 2011. ,
Global Kinomic and Phospho-Proteomic Analyses of the Human Malaria Parasite Plasmodium Falciparum, Nature Communications, vol.2, issue.1, pp.512-65, 2011. ,
Protein Export into Malaria ParasiteInfected Erythrocytes: Mechanisms and Functional Consequences, Annual Review of Biochemistry, vol.84, issue.1, pp.813-854, 2015. ,
Protein AMPylation by an Evolutionarily Conserved Pseudokinase, Cell, vol.175, issue.3, pp.809-821, 2018. ,
Plasmodium Falciparum SERA5 Plays a NonEnzymatic Role in the Malarial Asexual Blood-Stage Lifecycle, Molecular Microbiology, vol.96, issue.2, pp.368-87, 2015. ,
Serine/Threonine Protein Kinases from Bacteria, Archaea and Eukarya Share a Common Evolutionary Origin Deeply Rooted in the Tree of Life, Journal of Molecular Biology, vol.430, issue.1, pp.27-32, 2018. ,
The Crystal Structure of an Eph Receptor SAM Domain Reveals a Mechanism for Modular Dimerization, Nature Structural Biology, vol.6, issue.1, pp.44-49, 1999. ,
Gametocyte Sex Ratio: The Key to Understanding Plasmodium Falciparum Transmission?, Trends in Parasitology, vol.xx, pp.1-13, 2018. ,
,
Junctophilins: A Novel Family of Junctional Membrane Complex Proteins, Molecular Cell, vol.6, issue.1, pp.3-4, 2000. ,
Current Classification of Apicomplexan Kinomes, Protein Phosphorylation in Parasites, pp.19-22, 2013. ,
Structural and Evolutionary Divergence of Eukaryotic Protein Kinases in Apicomplexa, BMC Evolutionary Biology, vol.11, issue.1, p.321, 2011. ,
An Evolutionary Perspective on the Kinome of Malaria Parasites, Philosophical Transactions of the Royal Society B: Biological Sciences, vol.367, pp.2607-2625, 1602. ,
A Bite to Fight: Front-Line Innate Immune Defenses against Malaria Parasites, Pathogens and Global Health, vol.112, issue.1, pp.1-12, 2018. ,
,
A Saliva-Based Rapid Test to Quantify the Infectious Subclinical Malaria Parasite Reservoir, Science Translational Medicine, vol.11, 2019. ,
,
Evolution of the Eukaryotic Protein Kinases as Dynamic Molecular Switches, Philosophical Transactions of the Royal Society B: Biological Sciences, vol.367, pp.2517-2545, 1602. ,
Protein Kinases: Evolution of Dynamic Regulatory Proteins, Trends in Biochemical Sciences, vol.36, issue.2, pp.65-77, 2011. ,
,
Identification of Plasmodium Falciparum Translation Initiation EIF2? Subunit: Direct Interaction with Protein Phosphatase Type 1, Frontiers in Microbiology, vol.7, pp.1-16, 2016. ,
The Systematic Functional Analysis of Plasmodium Protein Kinases Identifies Essential Regulators of Mosquito Transmission, Cell Host and Microbe, vol.8, issue.4, pp.377-87, 2010. ,
Alternative Protein Secretion in the Malaria Parasite Plasmodium Falciparum, PLoS ONE, vol.10, issue.4, pp.1-18, 2015. ,
Comparative Surface Geometry of the Protein Kinase Family, Protein Science, vol.18, issue.10, pp.2016-2042, 2009. ,
Evolution of Malaria Parasite Plastid Targeting Sequences, Proceedings of the National Academy of Sciences of the United States of America, vol.105, issue.12, pp.4781-85, 2008. ,
Host Cell Invasion by Apicomplexan Parasites: Insights from the Co-Structure of AMA1 with a RON2 Peptide, Science, vol.333, issue.6041, pp.463-67, 2011. ,
URL : https://hal.archives-ouvertes.fr/hal-02115756
Release of Merozoite Dense Granules during Erythrocyte Invasion by Plasmodium Knowlesi, Infection and Immunity, vol.57, issue.10, pp.3230-3263, 1989. ,
Human Malaria Parasites in Continuous Culture, Science, vol.193, issue.4254, pp.673-75, 1976. ,
Clinical Review: Severe Malaria, Critical Care, vol.7, issue.4, pp.315-338, 2003. ,
High-Throughput Profiling of NMyristoylation Substrate Specificity across Species Including Pathogens, Proteomics, vol.13, issue.1, pp.25-36, 2013. ,
The Phosphoproteomes of Plasmodium Falciparum and Toxoplasma Gondii Reveal Unusual Adaptations within and beyond the Parasites' Boundaries, Cell Host and Microbe, vol.10, issue.4, pp.410-429, 2011. ,
,
Ins and Outs of Kinase DFG Motifs, Chemistry and Biology, vol.20, issue.6, pp.745-791, 2013. ,
, Gymnodinioid Dinoflagellate Symbionts of Marine Invertebrates, vol.23, pp.469-81, 1987.
Dynamic Targeting of Protein Phosphatase 1 within the Nuclei of Living Mammalian Cells, Journal of Cell Science, vol.114, issue.23, pp.4219-4247, 2001. ,
Parasites Causing Cerebral Falciparum Malaria Bind Multiple Endothelial Receptors and Express EPCR and ICAM-1-Binding PfEMP1, Journal of Infectious Diseases, vol.215, issue.12, pp.1918-1943, 2017. ,
Understanding and Exploiting Substrate Recognition by Protein Kinases, Current Opinion in Chemical Biology, vol.12, issue.1, pp.4-10, 2008. ,
Malaria -An Overview, FEBS Journal, vol.274, issue.18, pp.4670-79, 2007. ,
Plasmodium Liver Infection and Exoerythrocytic Biology, 2017. ,
The PfAlba1 RNA-Binding Protein Is an Important Regulator of Translational Timing in Plasmodium Falciparum Blood Stages, Genome Biology, vol.16, issue.1, pp.1-18, 2015. ,
,
Biogenesis and Activity Regulation of Protein Phosphatase 1, Biochemical Society Transactions, vol.45, issue.1, pp.89-99, 2017. ,
Efficient CRISPR/Cas9-Mediated Genome Editing in P. Falciparum, Nature Methods, vol.11, issue.9, pp.915-933, 2014. ,
Degeneracy and Function of the Ubiquitous RVXF Motif That Mediates Binding to Protein Phosphatase-1, Journal of Biological Chemistry, vol.278, issue.21, pp.18817-18840, 2003. ,
,
Protein Trafficking To the Plastid of Plasmodium Falciparum Is via the Secretory Pathway, The EMBO Journal, vol.19, issue.8, pp.1794-1802, 2000. ,
Effects of Liver-Stage Clearance by Primaquine on Gametocyte Carriage of Plasmodium Vivax and P. Falciparum, Plos Neglected Tropical Diseases, vol.11, issue.7, p.5753, 2017. ,
Post-Transcriptional and Translational Regulation Modulates Gene Co-Expression Behavior in More Synchronized Pace to Carry out Molecular Function in the Cell, Gene, vol.587, issue.2, pp.163-68, 2016. ,
,
Protein S -Nitrosylation in Plasmodium Falciparum, Antioxidants & Redox Signaling, vol.20, issue.18, pp.2923-2958, 2014. ,
Autoinhibition of Bruton's Tyrosine Kinase (Btk) and Activation by Soluble Inositol Hexakisphosphate, ELife, vol.2015, issue.4, pp.1-31, 2015. ,
Phosphatase Inhibitor-2 Balances Protein Phosphatase 1 and Aurora B Kinase for Chromosome Segregation and Cytokinesis in Human Retinal Epithelial Cells, Molecular Biology of the Cell, vol.19, pp.4852-62, 2008. ,
,
Staurosporine Inhibits Invasion of Erythrocytes by Malarial Merozoites, Experimental Parasitology, vol.79, pp.480-87, 1994. ,
Protein Kinases of the Human Malaria Parasite Plasmodium Falciparum: The Kinome of a Divergent Eukaryote, BMC Genomics, vol.5, pp.1-19, 2004. ,
URL : https://hal.archives-ouvertes.fr/inserm-00103327
Plasmodium Falciparum Appears to Have Arisen as a Result of Lateral Transfer between Avian and Human Hosts, Proceedings of the National Academy of Sciences USA, vol.88, pp.3140-3184, 1991. ,
Chromera Velia. The Missing Link in the Evolution of Parasitism, Advances in Applied Microbiology. 1st ed, vol.85, 2013. ,
Dried-Leaf Artemisia Annua : A Practical Malaria Therapeutic for Developing Countries?, World Journal of Pharmacology, vol.3, issue.4, pp.39-55, 2014. ,
Overlaying Molecular and Temporal Aspects of Malaria Parasite Invasion, Trends in Parasitology, vol.32, issue.4, pp.284-95, 2016. ,
, Plasmodium Vivax and Plasmodium Falciparum Infection Dynamics: ReInfections, Recrudescences and Relapses, vol.17, pp.1-15, 2018.
Vector Control Advisory Group ( VCAG ) on New Tools , Technologies and Approaches -Terms of Reference 1, pp.1-7, 2017. ,
, WHO Guidelines for the Treatment of Malaria -3rd Edition, p.90261, 2015.
, Status Report on Artemisinin and ACT Resistance, vol.9, 2011.
, Artemisinin Resistance and Artemisinin-Based Combination Therapy Efficacy (Status Report, 2017c. WORLD MALARIA REPORT 2017. Licence CC BY-NC-SA 3.0 IGO, vol.13, 2017.
, Malaria Vaccine: WHO Position Paper, Vaccine, vol.36, issue.25, pp.3576-77, 2016.
The Protein-Phosphatome of the Human Malaria Parasite Plasmodium Falciparum, BMC Genomics, vol.9, pp.1-19, 2008. ,
Non-Falciparum Malaria Infections in Pregnant Women in West Africa, Malaria Journal, vol.15, issue.1, pp.1-8, 2016. ,
Complete Gene Map of the Plastid-like DNA of the Malaria Parasite Plasmodium Falciparum, Journal of Molecular Biology, vol.261, issue.2, pp.155-72, 1996. ,
,
Increased Tolerance to Artemisinin in Plasmodium Falciparum Is Mediated by a Quiescence Mechanism, Antimicrobial Agents and Chemotherapy, vol.54, issue.5, pp.1872-77, 2010. ,
Validation of N-Myristoyltransferase as an Antimalarial Drug Target Using an Integrated Chemical Biology Approach, Nature Chemistry, vol.6, pp.112-133, 2014. ,
S-Glutathionylation: From Molecular Mechanisms to Health Outcomes, Antioxidants & Redox Signaling, vol.15, issue.1, pp.233-70, 2011. ,
No MiRNA Were Found in Plasmodium and the Ones Identified in Erythrocytes Could Not Be Correlated with Infection, Malaria Journal, vol.7, pp.1-6, 2008. ,
Protective Epitopes of the Plasmodium Falciparum SERA5 Malaria Vaccine Reside in Intrinsically Unstructured N-Terminal Repetitive Sequences, PLoS ONE, vol.9, issue.6, pp.1-10, 2014. ,
Antibody Titres and Boosting after Natural Malaria Infection in BK-SE36 Vaccine Responders during a Follow-up Study in Uganda, Scientific Reports, vol.6, pp.2-9, 2016. ,
Comparative Monomethylarginine Proteomics Suggests That Protein Arginine Methyltransferase 1 (PRMT1) Is a Significant Contributor to Arginine Monomethylation in Toxoplasma Gondii, Molecular & Cellular Proteomics, vol.16, issue.4, pp.567-80, 2017. ,
Posttranslational Modifications as Key Regulators of Apicomplexan Biology: Insights from Proteome-Wide Studies Rama, Molecular Microbiology, vol.107, issue.1, pp.1-23, 2018. ,
The Serine/Threonine Phosphatases of Apicomplexan Parasites, Molecular Microbiology, vol.106, issue.1, pp.1-21, 2017. ,
Chemical Rescue of Malaria Parasites Lacking an Apicoplast Defines Organelle Function in Blood-Stage Plasmodium Falciparum, PLoS Biology, vol.9, issue.8, 2011. ,
,
Pseudokinases-Remnants of Evolution or Key Allosteric Regulators?, Current Opinion in Structural Biology, vol.20, issue.6, pp.772-81, 2010. ,
,
The Role of Pseudokinases in Cancer, Cellular Signalling, vol.24, issue.6, pp.1173-84, 2012. ,
,
UIS2: A Unique Phosphatase Required for the Development of Plasmodium Liver Stages, PLoS Pathogens, vol.12, issue.1, pp.1-20, 2016. ,
Uncovering the Essential Genes of the Human Malaria Parasite Plasmodium Falciparum by Saturation Mutagenesis, Science, vol.360, issue.6388, 2018. ,
, , vol.226
, , pp.100-138
,
, | PBANKA_094010 216 CESTSKSIGSDYISHFEKKEKQINKQEDELKKSKENYMNHSEYSNSSTNF, vol.265, pp.366-400
, , vol.457, pp.3-7
,
, , vol.542, pp.3-7
, , pp.94010-531
,
, PBANKA_094010, vol.834, pp.LFSYLHCVKYKHIYVSKLLKYY-QKKFINQNFQQQNNTMSSDR
,
,
, LKNKISQKKINKKLNFKAK 1024 PF3D7_1106800 1209 IQMNQPYTFPPYQKELSSYLKNEKIKRKRKVLFSYLKTHIHFNSQQINDQ 1258 |::|:||.|||.|::.:.|| ||.|:|:|, pp.94010-1000
, Le programme a également rendu les résultats suivants : # Identité : 577/1593 (36.2%)
,
,
,