. Iiia and . Jpred, Recherche de fragments solubles Plusieurs programmes, dont les adresses internet sont listées ci-dessoux, ont été utilisés pour prédire la nature et la présence de structures secondaires dans la protéine IIIa: http://dis.embl, HHHHHHHHHHHHHH IIIa: 526YAQEHRDVPGPRPPTRRQRHDRQRGLVWEDDDSADDSSVLDLGGSGNPFAHLRPRLGRMF Jpred

X. Crystallography, . Celo-short-fibre, . Head, A. T. Brunger, P. D. Adams et al., Crystallography & NMR system: A new software suite for macromolecular structure determination, Email: schoehn@embl.fr Keywords: structure, pp.905-921, 1998.

W. P. Burmeister, D. Guilligay, S. Cusack, G. Wadell, and N. Arnberg, Crystal Structure of Species D Adenovirus Fiber Knobs and Their Sialic Acid Binding Sites, Journal of Virology, vol.78, issue.14, pp.7727-7736, 2004.
DOI : 10.1128/JVI.78.14.7727-7736.2004

R. M. Burnett, The structure of the adenovirus capsid, Journal of Molecular Biology, vol.185, issue.1, pp.125-143, 1985.
DOI : 10.1016/0022-2836(85)90187-1

R. M. Burnett, M. G. Grutter, and J. L. White, The structure of the adenovirus capsid, Journal of Molecular Biology, vol.185, issue.1, pp.105-123, 1985.
DOI : 10.1016/0022-2836(85)90186-X

L. D. Cahan and J. C. Paulson, Polyorna virus adsorbs to specific sialyloligosaccharide receptors on erythrocytes, Virology, vol.103, issue.2, pp.505-509, 1980.
DOI : 10.1016/0042-6822(80)90208-1

S. K. Campos and M. A. Barry, Current Advances and Future Challenges in Adenoviral Vector Biology and Targeting, Current Gene Therapy, vol.7, issue.3, pp.189-204, 2007.
DOI : 10.2174/156652307780859062

S. K. Campos, M. B. Parrott, and M. A. Barry, Avidin-based targeting and purification of a protein IX-modified, metabolically biotinylated adenoviral vector, Molecular Therapy, vol.9, issue.6, pp.942-954, 2004.
DOI : 10.1016/j.ymthe.2004.03.006

J. M. Casasnovas, M. Larvie, and T. Stehle, Crystal structure of two CD46 domains reveals an extended measles virus-binding surface, The EMBO Journal, vol.18, issue.11, pp.2911-2922, 1999.
DOI : 10.1093/emboj/18.11.2911

P. K. Chatterjee, M. E. Vayda, and S. J. Flint, Interactions among the three adenovirus core proteins, J Virol, vol.55, pp.379-386, 1985.

P. K. Chatterjee, M. E. Vayda, and S. J. Flint, Identification of proteins and protein domains that contact DNA within adenovirus nucleoprotein cores by ultraviolet light crosslinking of oligonucleotides 32P-labelled in vivo, Journal of Molecular Biology, vol.188, issue.1, pp.23-37, 1986.
DOI : 10.1016/0022-2836(86)90477-8

C. C. Chee-sheung and H. S. Ginsberg, Characterization of a temperature-sensitive fiber mutant of type 5 adenovirus and effect of the mutation on virion assembly, J Virol, vol.42, pp.932-950, 1982.

S. K. Chiou, C. C. Tseng, L. Rao, and E. White, Functional complementation of the adenovirus E1B 19-kilodalton protein with Bcl-2 in the inhibition of apoptosis in infected cells, J Virol, vol.68, pp.6553-6566, 1994.

J. Chroboczek, F. Viard, D. 'halluin, and J. C. , Human adenovirus 2 temperature-sensitive mutant 112 contains three mutations in the protein IIIa gene, Gene, vol.49, issue.1, pp.157-160, 1986.
DOI : 10.1016/0378-1119(86)90396-3

Y. Chu, D. Heistad, M. I. Cybulsky, D. , and B. L. , Vascular Cell Adhesion Molecule-1 Augments Adenovirus-Mediated Gene Transfer, Arteriosclerosis, Thrombosis, and Vascular Biology, vol.21, issue.2, pp.238-242, 2001.
DOI : 10.1161/01.ATV.21.2.238

W. W. Colby and T. Shenk, Adenovirus type 5 virions can be assembled in vivo in the absence of detectable polypeptide IX, J Virol, vol.39, pp.977-980, 1981.

L. Crawford-miksza and D. P. Schnurr, Analysis of 15 adenovirus hexon proteins reveals the location and structure of seven hypervariable regions containing serotype-specific residues, J Virol, vol.70, pp.1836-1844, 1996.

M. A. Croyle, M. Stone, G. L. Amidon, and B. J. Roessler, In vitro and in vivo asessment of adenovirus 41 as a vector for gene delivery to the intestine, Gene Therapy, vol.5, issue.5, pp.645-654, 1998.
DOI : 10.1038/sj.gt.3300645

D. 'halluin, J. C. Cousin, C. Boulanger, and P. , Physical mapping of adenovirus type 2, 1982.

D. 'halluin, J. C. Milleville, M. Martin, G. R. Boulanger, and P. , Morphogenesis of human adenovirus type 2 studied with fiber-and fiber and penton base-defective temperature-sensitive mutants, J Virol, vol.33, pp.88-99, 1980.

A. J. Davison, M. Benko, and B. Harrach, Genetic content and evolution of adenoviruses, Journal of General Virology, vol.84, issue.11, pp.2895-2908, 2003.
DOI : 10.1099/vir.0.19497-0

E. Davison, R. M. Diaz, I. R. Hart, G. Santis, M. et al., Integrin alpha5beta1- mediated adenovirus infection is enhanced by the integrin-activating antibody TS2/16, J Virol, vol.71, pp.6204-6207, 1997.

E. Davison, I. Kirby, T. Elliott, and G. Santis, The human HLA-A*0201 allele, expressed in hamster cells, is not a high-affinity receptor for adenovirus type 5 fiber, J Virol, vol.73, pp.4513-4517, 1999.

D. Jong, J. C. Wermenbol, A. G. Verweij-uijterwaal, M. W. Slaterus, K. W. Wertheim-van-dillen et al., Adenoviruses from human immunodeficiency virus-infected individuals, including two strains that represent new candidate serotypes Ad50 and Ad51 of species B1 and D, respectively, J Clin Microbiol, vol.37, pp.3940-3945, 1999.

M. C. Dechecchi, A. Tamanini, A. Bonizzato, C. , and G. , Heparan Sulfate Glycosaminoglycans Are Involved in Adenovirus Type 5 and 2-Host Cell Interactions, Virology, vol.268, issue.2, pp.382-390, 2000.
DOI : 10.1006/viro.1999.0171

J. Dekker, P. N. Kanellopoulos, A. K. Loonstra, J. A. Van-oosterhout, K. Leonard et al., Multimerization of the adenovirus DNA-binding protein is the driving force for ATP-independent DNA unwinding during strand displacement synthesis, The EMBO Journal, vol.16, issue.6, pp.1455-1463, 1997.
DOI : 10.1093/emboj/16.6.1455

J. Ding, W. J. Mcgrath, R. M. Sweet, and W. F. Mangel, Crystal structure of the human adenovirus proteinase with its 11 amino acid cofactor, Embo J, vol.15, pp.1778-1783, 1996.

I. Dmitriev, V. Krasnykh, C. R. Miller, M. Wang, E. Kashentseva et al., An adenovirus vector with genetically modified fibers demonstrates expanded tropism via utilization of a coxsackievirus and adenovirus receptor-independent cell entry mechanism, J Virol, vol.72, pp.9706-9713, 1998.

I. P. Dmitriev, E. A. Kashentseva, and D. T. Curiel, Engineering of Adenovirus Vectors Containing Heterologous Peptide Sequences in the C Terminus of Capsid Protein IX, Journal of Virology, vol.76, issue.14, pp.6893-6899, 2002.
DOI : 10.1128/JVI.76.14.6893-6899.2002

C. Durmort, C. Stehlin, G. Schoehn, A. Mitraki, E. Drouet et al., Structure of the Fiber Head of Ad3, a Non-CAR-Binding Serotype of Adenovirus, Virology, vol.285, issue.2, pp.302-312, 2001.
DOI : 10.1006/viro.2001.0967

P. Él?, S. L. Farkas, A. L. Dán, M. , and K. G. , The p32K Structural Protein of the Atadenovirus Might Have Bacterial Relatives, Journal of Molecular Evolution, vol.56, issue.2, pp.175-180, 2002.
DOI : 10.1007/s00239-002-2391-4

P. Emsley and K. Cowtan, : model-building tools for molecular graphics, Acta Crystallographica Section D Biological Crystallography, vol.60, issue.12, pp.2126-2132, 2004.
DOI : 10.1107/S0907444904019158

J. D. Evans and P. Hearing, Distinct Roles of the Adenovirus E4 ORF3 Protein in Viral DNA Replication and Inhibition of Genome Concatenation, Journal of Virology, vol.77, issue.9, pp.5295-5304, 2003.
DOI : 10.1128/JVI.77.9.5295-5304.2003

E. Everitt, L. Lutter, and L. Philipson, Structural proteins of adenoviruses, Virology, vol.67, issue.1, pp.197-208, 1975.
DOI : 10.1016/0042-6822(75)90417-1

E. Everitt, B. Sundquist, U. Pettersson, and L. Philipson, Structural proteins of adenoviruses, Virology, vol.52, issue.1, pp.130-147, 1973.
DOI : 10.1016/0042-6822(73)90404-2

C. M. Fabry, M. Rosa-calatrava, J. F. Conway, C. Zubieta, S. Cusack et al., A quasi-atomic model of human adenovirus type 5 capsid, The EMBO Journal, vol.17, issue.9, pp.1645-1654, 2005.
DOI : 10.1038/sj.emboj.7600653

B. Falgout and G. Ketner, Characterization of adenovirus particles made by deletion mutants lacking the fiber gene, J Virol, vol.62, pp.622-625, 1988.

A. L. Favier, W. P. Burmeister, C. , and J. , Unique physicochemical properties of human enteric Ad41 responsible for its survival and replication in the gastrointestinal tract, Virology, vol.322, issue.1, pp.93-104, 2004.
DOI : 10.1016/j.virol.2004.01.020

A. L. Favier, G. Schoehn, M. Jaquinod, C. Harsi, C. et al., Structural Studies of Human Enteric Adenovirus Type 41, Virology, vol.293, issue.1, pp.75-85, 2002.
DOI : 10.1006/viro.2001.1235

P. Fender, A. Boussaid, P. Mezin, C. , and J. , Synthesis, cellular localization, and quantification of penton-dodecahedron in serotype 3 adenovirus-infected cells, Virology, vol.340, issue.2, pp.167-173, 2005.
DOI : 10.1016/j.virol.2005.06.030

P. Fender, R. W. Ruigrok, E. Gout, S. Buffet, C. et al., Adenovirus dodecahedron, a new vector for human gene transfer, Nature Biotechnology, vol.18, issue.1, pp.52-56, 1997.
DOI : 10.1016/0378-1119(94)90302-6

P. Fender, G. Schoehn, J. Foucaud-gamen, E. Gout, A. Garcel et al., Adenovirus Dodecahedron Allows Large Multimeric Protein Transduction in Human Cells, Journal of Virology, vol.77, issue.8, pp.4960-4964, 2003.
DOI : 10.1128/JVI.77.8.4960-4964.2003

C. Fleischli, D. Sirena, G. Lesage, M. J. Havenga, R. Cattaneo et al., Species B adenovirus serotypes 3, 7, 11 and 35 share similar binding sites on the membrane cofactor protein CD46 receptor, Journal of General Virology, vol.88, issue.11, pp.2925-2934, 2007.
DOI : 10.1099/vir.0.83142-0

C. Fleischli, S. Verhaagh, M. Havenga, D. Sirena, W. Schaffner et al., The Distal Short Consensus Repeats 1 and 2 of the Membrane Cofactor Protein CD46 and Their Distance from the Cell Membrane Determine Productive Entry of Species B Adenovirus Serotype 35, Journal of Virology, vol.79, issue.15, pp.10013-10022, 2005.
DOI : 10.1128/JVI.79.15.10013-10022.2005

S. J. Flint and R. A. Gonzalez, Regulation of mRNA Production by the Adenoviral E1B 55-kDa and E4 Orf6 Proteins, Curr Top Microbiol Immunol, vol.272, pp.287-330, 2003.
DOI : 10.1007/978-3-662-05597-7_10

P. S. Furcinitti, J. Van-oostrum, and R. M. Burnett, Adenovirus polypeptide IX revealed as capsid cement by difference images from electron microscopy and crystallography, Embo J, vol.8, pp.3563-3570, 1989.

P. Fuschiotti, P. Fender, G. Schoehn, C. , and J. F. , Development of the dodecahedral penton particle from adenovirus 3 for therapeutic application, Journal of General Virology, vol.87, issue.10, pp.2901-2905, 2006.
DOI : 10.1099/vir.0.82025-0

P. Fuschiotti, G. Schoehn, P. Fender, C. M. Fabry, E. A. Hewat et al., Structure of the Dodecahedral Penton Particle from Human Adenovirus Type 3, Journal of Molecular Biology, vol.356, issue.2, pp.510-520, 2006.
DOI : 10.1016/j.jmb.2005.11.048

A. Gaggar, D. M. Shayakhmetov, and A. Lieber, CD46 is a cellular receptor for group B adenoviruses, Nature Medicine, vol.9, issue.11, pp.1408-1412, 1419.
DOI : 10.1038/nm952

R. Gardlik, R. Palffy, J. Hodosy, J. Lukacs, J. Turna et al., Vectors and delivery systems in gene therapy, Med Sci Monit, vol.11, pp.110-121, 2005.

C. T. Garnett, D. Erdman, W. Xu, and L. R. Gooding, Prevalence and Quantitation of Species C Adenovirus DNA in Human Mucosal Lymphocytes, Journal of Virology, vol.76, issue.21, pp.10608-10616, 2002.
DOI : 10.1128/JVI.76.21.10608-10616.2002

G. Ghosh-choudhury, Y. Haj-ahmad, G. , and F. L. , Protein IX, a minor component of the human adenovirus capsid, is essential for the packaging of full length genomes, Embo J, vol.6, pp.1733-1739, 1987.

E. Giannakis, T. S. Jokiranta, R. J. Ormsby, T. G. Duthy, D. A. Male et al., Identification of the streptococcal M-protein binding site on membrane cofactor protein (CD46), Immunopharmacology, vol.49, issue.1-2, pp.4585-4592, 2002.
DOI : 10.1016/S0162-3109(00)80188-5

U. F. Greber, Signalling in viral entry, Cellular and Molecular Life Sciences (CMLS), vol.59, issue.4, pp.608-626, 2002.
DOI : 10.1007/s00018-002-8453-3

U. F. Greber, W. , and M. , A Superhighway to Virus Infection, Cell, vol.124, issue.4, pp.741-754, 2006.
DOI : 10.1016/j.cell.2006.02.018

U. F. Greber, P. Webster, J. Weber, and A. Helenius, The role of the adenovirus protease on virus entry into cells, Embo J, vol.15, pp.1766-1777, 1996.

U. F. Greber, M. Willetts, P. Webster, and A. Helenius, Stepwise dismantling of adenovirus 2 during entry into cells, Cell, vol.75, issue.3, pp.477-486, 1993.
DOI : 10.1016/0092-8674(93)90382-Z

H. L. Greenstone, F. Santoro, P. Lusso, and E. A. Berger, Human Herpesvirus 6 and Measles Virus Employ Distinct CD46 Domains for Receptor Function, Journal of Biological Chemistry, vol.277, issue.42, pp.39112-39118, 2002.
DOI : 10.1074/jbc.M206488200

R. J. Greenwald, G. J. Freeman, and A. H. Sharpe, THE B7 FAMILY REVISITED, Annual Review of Immunology, vol.23, issue.1, pp.515-548, 2005.
DOI : 10.1146/annurev.immunol.23.021704.115611

J. M. Greve, G. Davis, A. M. Meyer, C. P. Forte, S. C. Yost et al., The major human rhinovirus receptor is ICAM-1, Cell, vol.56, issue.5, pp.839-847, 1989.
DOI : 10.1016/0092-8674(89)90688-0

D. J. Gustafsson, A. Segerman, K. Lindman, Y. F. Mei, and G. Wadell, The Arg279Glu Substitution in the Adenovirus Type 11p (Ad11p) Fiber Knob Abolishes EDTA-Resistant Binding to A549 and CHO-CD46 Cells, Converting the Phenotype to That of Ad7p, Journal of Virology, vol.80, issue.4, pp.1897-1905, 2006.
DOI : 10.1128/JVI.80.4.1897-1905.2006

C. Hannan, L. H. Raptis, C. V. Dery, W. , and J. , Biological and Structural Studies with an Adenovirus Type 2 Temperature-Sensitive Mutant Defective for Uncoating, Intervirology, vol.19, issue.4, pp.213-223, 1983.
DOI : 10.1159/000149363

J. N. Harada, A. Shevchenko, A. Shevchenko, D. C. Pallas, and A. J. Berk, Analysis of the Adenovirus E1B-55K-Anchored Proteome Reveals Its Link to Ubiquitination Machinery, Journal of Virology, vol.76, issue.18, pp.9194-9206, 2002.
DOI : 10.1128/JVI.76.18.9194-9206.2002

W. A. Hendrickson, J. R. Horton, and D. M. Lemaster, Selenomethionyl proteins produced for analysis by multiwavelength anomalous diffraction (MAD): a vehicle for direct determination of three-dimensional structure, Embo J, vol.9, pp.1665-1672, 1990.

M. Hess, A. Cuzange, R. W. Ruigrok, J. Chroboczek, and B. Jacrot, The Avian Adenovirus Penton: Two Fibers and One Base, Journal of Molecular Biology, vol.252, issue.4, pp.379-385, 1995.
DOI : 10.1006/jmbi.1995.0504

J. C. Hierholzer, Adenoviruses in the immunocompromised host., Clinical Microbiology Reviews, vol.5, issue.3, pp.262-274, 1992.
DOI : 10.1128/CMR.5.3.262

J. C. Hierholzer, R. Wigand, L. J. Anderson, T. Adrian, and J. W. Gold, Adenoviruses from Patients with AIDS: A Plethora of Serotypes and A Description of Five New Serotypes of Subgenus D (Types 43-47), Journal of Infectious Diseases, vol.158, issue.4, pp.804-813, 1988.
DOI : 10.1093/infdis/158.4.804

S. S. Hong, N. A. Habib, L. Franqueville, S. Jensen, and P. A. Boulanger, Identification of Adenovirus (Ad) Penton Base Neutralizing Epitopes by Use of Sera from Patients Who Had Received Conditionally Replicative Ad (Addl1520) for Treatment of Liver Tumors, Journal of Virology, vol.77, issue.19, pp.10366-10375, 2003.
DOI : 10.1128/JVI.77.19.10366-10375.2003
URL : https://hal.archives-ouvertes.fr/hal-00118798

S. S. Hong, L. Karayan, J. Tournier, D. T. Curiel, and P. A. Boulanger, Adenovirus type 5 fiber knob binds to MHC class I ??2 domain at the surface of human epithelial and B lymphoblastoid cells, The EMBO Journal, vol.2, issue.9, pp.2294-2306, 1997.
DOI : 10.1093/emboj/16.9.2294

J. Howitt, M. C. Bewley, V. Graziano, J. M. Flanagan, and P. Freimuth, Structural Basis for Variation in Adenovirus Affinity for the Cellular Coxsackievirus and Adenovirus Receptor, Journal of Biological Chemistry, vol.278, issue.28, pp.26208-26215, 2003.
DOI : 10.1074/jbc.M301492200

S. Huang, T. Kamata, Y. Takada, Z. M. Ruggeri, and G. R. Nemerow, Adenovirus interaction with distinct integrins mediates separate events in cell entry and gene delivery to hematopoietic cells, J Virol, vol.70, pp.4502-4508, 1996.

S. Huang, V. Reddy, N. Dasgupta, and G. R. Nemerow, A single amino acid in the adenovirus type 37 fiber confers binding to human conjunctival cells, J Virol, vol.73, pp.2798-2802, 1999.

H. C. Hurst, Transcription factors 1: bZIP proteins, Protein Profile, vol.2, pp.101-168, 1995.

Y. M. Jin, I. U. Pardoe, A. T. Burness, and T. I. Michalak, Identification and characterization of the cell surface 70-kilodalton sialoglycoprotein(s) as a candidate receptor for encephalomyocarditis virus on human nucleated cells, J Virol, vol.68, pp.7308-7319, 1994.

W. Kabsch, Evaluation of single-crystal X-ray diffraction data from a position-sensitive detector, Journal of Applied Crystallography, vol.21, issue.6, pp.916-924, 1988.
DOI : 10.1107/S0021889888007903

N. Kaludov, K. E. Brown, R. W. Walters, J. Zabner, C. et al., Adeno-Associated Virus Serotype 4 (AAV4) and AAV5 Both Require Sialic Acid Binding for Hemagglutination and Efficient Transduction but Differ in Sialic Acid Linkage Specificity, Journal of Virology, vol.75, issue.15, pp.6884-6893, 2001.
DOI : 10.1128/JVI.75.15.6884-6893.2001

Z. T. Kelleher and J. M. Vos, Long-term episomal gene delivery in human lymphoid cells using human and avian adenoviral-assisted transfection, Biotechniques, vol.17, pp.1110-1117, 1994.

I. Kirby, E. Davison, A. J. Beavil, C. P. Soh, T. J. Wickham et al., Identification of Contact Residues and Definition of the CAR-Binding Site of Adenovirus Type 5 Fiber Protein, Journal of Virology, vol.74, issue.6, pp.2804-2813, 2000.
DOI : 10.1128/JVI.74.6.2804-2813.2000

T. Kojaoghlanian, P. Flomenberg, and M. S. Horwitz, The impact of adenovirus infection on the immunocompromised host, Reviews in Medical Virology, vol.27, issue.3, pp.155-171, 2003.
DOI : 10.1002/rmv.386

E. J. Kremer, Gene Transfer to the Central Nervous System: Current State of the Art of the Viral Vectors, Current Genomics, vol.6, issue.1, pp.13-39, 2005.
DOI : 10.2174/1389202053202111

J. Lanciotti, A. Song, J. Doukas, B. Sosnowski, G. Pierce et al., Targeting adenoviral vectors using heterofunctional polyethylene glycol FGF2 conjugates, Molecular Therapy, vol.8, issue.1, pp.99-107, 2003.
DOI : 10.1016/S1525-0016(03)00139-4

W. G. Laver, H. B. Younghusband, and N. G. Wrigley, Purification and properties of chick embryo lethal orphan virus (an avian adenovirus), Virology, vol.45, issue.3, pp.598-614, 1971.
DOI : 10.1016/0042-6822(71)90175-9

L. P. Le, M. Everts, I. P. Dmitriev, J. G. Davydova, M. Yamamoto et al., Fluorescently Labeled Adenovirus with pIX-EGFP for Vector Detection, Molecular Imaging, vol.3, issue.2, pp.105-116, 2004.
DOI : 10.1162/1535350041464874

A. M. Leen and C. M. Rooney, Adenovirus as an emerging pathogen in immunocompromised patients, British Journal of Haematology, vol.7, issue.1, pp.135-144, 2005.
DOI : 10.1016/S0952-7915(99)80064-8

E. Lehmberg, J. A. Traina, J. A. Chakel, R. J. Chang, M. Parkman et al., Reversed-phase high-performance liquid chromatographic assay for the adenovirus type 5 proteome, Journal of Chromatography B: Biomedical Sciences and Applications, vol.732, issue.2, pp.411-423, 1999.
DOI : 10.1016/S0378-4347(99)00316-3

A. G. Leslie, Recent changes to the MOSFLM package for processing film and image plate data, 1992.

E. Li, D. Stupack, G. M. Bokoch, and G. R. Nemerow, Adenovirus endocytosis requires actin cytoskeleton reorganization mediated by Rho family GTPases, J Virol, vol.72, pp.8806-8812, 1998.

Q. G. Li, J. Hambraeus, and G. Wadell, Genetic relationship between thirteen genome types of adenovirus 11, 34, and 35 with different tropisms, Intervirology, vol.32, pp.338-350, 1991.

H. Liebermann, K. Lotz, R. Mentel, U. Bauer, and W. Seidel, Mapping of linear epitopes on fibre knob of human adenovirus serotype 5, Virus Research, vol.73, issue.2, pp.145-151, 2001.
DOI : 10.1016/S0168-1702(00)00232-X

H. Liebermann, K. Lotz, and W. Seidel, Mapping of Epitopes on the Fiber Knobs of Human Adenovirus Serotypes 8 and 15, Intervirology, vol.45, issue.1, pp.59-66, 2002.
DOI : 10.1159/000050089

G. Q. Liu, L. E. Babiss, F. C. Volkert, C. S. Young, and H. S. Ginsberg, A thermolabile mutant of adenovirus 5 resulting from a substitution mutation in the protein VIII gene, J Virol, vol.53, pp.920-925, 1985.

K. Lonberg-holm, R. L. Crowell, and L. Philipson, Unrelated animal viruses share receptors, Nature, vol.1, issue.5545, pp.679-681, 1976.
DOI : 10.1038/259679a0

A. Lupas, Coiled coils: new structures and new functions, Trends in Biochemical Sciences, vol.21, issue.10, pp.375-382, 1996.
DOI : 10.1016/S0968-0004(96)10052-9

A. Lupas, [30] Prediction and analysis of coiled-coil structures, Methods Enzymol, vol.266, pp.513-525, 1996.
DOI : 10.1016/S0076-6879(96)66032-7

P. Lutz, M. Rosa-calatrava, and C. Kedinger, The product of the adenovirus intermediate gene IX is a transcriptional activator, J Virol, vol.71, pp.5102-5109, 1997.

M. Y. Nakano, K. Boucke, M. Suomalainen, R. P. Stidwill, and U. F. Greber, The First Step of Adenovirus Type 2 Disassembly Occurs at the Cell Surface, Independently of Endocytosis and Escape to the Cytosol, Journal of Virology, vol.74, issue.15, pp.7085-7095, 2000.
DOI : 10.1128/JVI.74.15.7085-7095.2000

D. Naniche, G. Varior-krishnan, F. Cervoni, T. F. Wild, B. Rossi et al., Human membrane cofactor protein (CD46) acts as a cellular receptor for measles virus, J Virol, vol.67, pp.6025-6032, 1993.

A. R. Neurath, B. A. Rubin, and J. T. Stasny, Cleavage by formamide of intercapsomer bonds in adenovirus types 4 and 7 virions and hemagglutinins, J Virol, vol.2, pp.1086-1095, 1968.

E. Norrby, The relationship between the soluble antigens and the virion of adenovirus type 3, Virology, vol.30, issue.4, pp.608-617, 1966.
DOI : 10.1016/0042-6822(66)90165-6

E. Norrby, Identification of Soluble Components of Adenovirus Type 11, Journal of General Virology, vol.2, issue.1, pp.123-133, 1968.
DOI : 10.1099/0022-1317-2-1-123

E. Norrby and J. Ankerst, Biological Characterization of Structural Components of Adenovirus type 12, Journal of General Virology, vol.5, issue.2, pp.183-194, 1969.
DOI : 10.1099/0022-1317-5-2-183

E. Norrby, A. Bartha, P. Boulanger, R. S. Dreizin, H. S. Ginsberg et al., Adenoviridae, Intervirology, vol.7, pp.117-125, 1976.

E. Norrby, B. Nyberg, P. Skaaret, and A. Lengyel, Separation and characterization of soluble adenovirus type 9 components, J Virol, vol.1, pp.1101-1108, 1967.

E. Norrby and P. Skaaret, Comparison between soluble components of adenovirus types 3, 1968.

E. Norrby and G. Wadell, Soluble components of adenovirus type 4, Virology, vol.31, issue.4, pp.592-600, 1967.
DOI : 10.1016/0042-6822(67)90187-0

D. Ojkic and E. Nagy, The complete nucleotide sequence of fowl adenovirus type 8, Journal of General Virology, vol.81, issue.7, pp.1833-1837, 2000.
DOI : 10.1099/0022-1317-81-7-1833

Z. Otwinowski and W. Minor, [20] Processing of X-ray diffraction data collected in oscillation mode, Methods in Enzymology, vol.276, pp.307-326, 1997.
DOI : 10.1016/S0076-6879(97)76066-X

R. J. Parks, Adenovirus Protein IX: A New Look at an Old Protein, Molecular Therapy, vol.11, issue.1, pp.19-25, 2005.
DOI : 10.1016/j.ymthe.2004.09.018

R. J. Parks, L. Chen, M. Anton, U. Sankar, M. A. Rudnicki et al., A helper-dependent adenovirus vector system: Removal of helper virus by Cre-mediated excision of the viral packaging signal, Proceedings of the National Academy of Sciences, vol.93, issue.24, pp.13565-13570, 1996.
DOI : 10.1073/pnas.93.24.13565

P. Perez-romero, K. E. Gustin, and M. J. Imperiale, Dependence of the Encapsidation Function of the Adenovirus L1 52/55-Kilodalton Protein on Its Ability To Bind the Packaging Sequence, Journal of Virology, vol.80, issue.4, pp.1965-1971, 2006.
DOI : 10.1128/JVI.80.4.1965-1971.2006

B. D. Persson, D. M. Reiter, M. Marttila, Y. F. Mei, J. M. Casasnovas et al., Adenovirus type 11 binding alters the conformation of its receptor CD46, Nature Structural & Molecular Biology, vol.6, issue.2, pp.164-166, 2007.
DOI : 10.1146/annurev.immunol.9.1.431

S. L. Pichla-gollon, M. Drinker, X. Zhou, F. Xue, J. J. Rux et al., Structure-Based Identification of a Major Neutralizing Site in an Adenovirus Hexon, Journal of Virology, vol.81, issue.4, pp.1680-1689, 2007.
DOI : 10.1128/JVI.02023-06

N. J. Pieniazek, S. B. Slemenda, D. Pieniazek, J. Velarde, . Jr et al., Human enteric adenovirus type 41 (Tak) contains a second fiber protein gene, Nucleic Acids Research, vol.18, issue.7, 1901.
DOI : 10.1093/nar/18.7.1901

L. Prage, U. Pettersson, S. Hoglund, K. Lonberg-holm, and L. Philipson, Structural proteins of adenoviruses, Virology, vol.42, issue.2, pp.341-358, 1970.
DOI : 10.1016/0042-6822(70)90278-3

G. N. Ramachandran and V. Sasisekharan, Conformation of Polypeptides and Proteins, 1968.
DOI : 10.1016/S0065-3233(08)60402-7

L. Rao, D. Perez, and E. White, Lamin proteolysis facilitates nuclear events during apoptosis, The Journal of Cell Biology, vol.135, issue.6, pp.1441-1455, 1996.
DOI : 10.1083/jcb.135.6.1441

D. T. Rein, M. Breidenbach, and D. T. Curiel, Current developments in adenovirus-based cancer gene therapy, Future Oncology, vol.2, issue.1, pp.137-143, 2006.
DOI : 10.2217/14796694.2.1.137

D. M. Rekosh, W. C. Russell, A. J. Bellet, R. , and A. J. , Identification of a protein linked to the ends of adenovirus DNA, Cell, vol.11, issue.2, pp.283-295, 1977.
DOI : 10.1016/0092-8674(77)90045-9

M. M. Roberts, J. L. White, M. G. Grutter, and R. M. Burnett, Three-dimensional structure of the adenovirus major coat protein hexon, Science, vol.232, issue.4754, pp.1148-1151, 1986.
DOI : 10.1126/science.3704642

P. W. Roelvink, A. Lizonova, J. G. Lee, Y. Li, J. M. Bergelson et al., The coxsackievirus-adenovirus receptor protein can function as a cellular attachment protein for adenovirus serotypes from subgroups, J Virol, vol.72, pp.7909-7915, 1998.

M. Rosa-calatrava, L. Grave, F. Puvion-dutilleul, B. Chatton, and C. Kedinger, Functional Analysis of Adenovirus Protein IX Identifies Domains Involved in Capsid Stability, Transcriptional Activity, and Nuclear Reorganization, Journal of Virology, vol.75, issue.15, pp.7131-7141, 2001.
DOI : 10.1128/JVI.75.15.7131-7141.2001

M. Rosa-calatrava, F. Puvion-dutilleul, P. Lutz, D. Dreyer, H. De-the et al., Adenovirus protein IX sequesters host-cell promyelocytic leukaemia protein and contributes to efficient viral proliferation, EMBO reports, vol.191, issue.10, pp.969-975, 2003.
DOI : 10.1038/sj.embor.embor943

W. P. Rowe, R. J. Huebner, L. K. Gilmore, R. H. Parrott, and T. G. Ward, Isolation of a Cytopathogenic Agent from Human Adenoids Undergoing Spontaneous Degeneration in Tissue Culture, Experimental Biology and Medicine, vol.84, issue.3, pp.570-573, 1953.
DOI : 10.3181/00379727-84-20714

R. W. Ruigrok, A. Barge, C. Albiges-rizo, and S. Dayan, Structure of adenovirus fibre, Journal of Molecular Biology, vol.215, issue.4, pp.589-596, 1990.
DOI : 10.1016/S0022-2836(05)80170-6

R. W. Ruigrok, A. Barge, S. K. Mittal, and B. Jacrot, The fibre of bovine adenovirus type 3 is very long but bent, Journal of General Virology, vol.75, issue.8, pp.2069-2073, 1994.
DOI : 10.1099/0022-1317-75-8-2069

J. J. Rux and R. M. Burnett, Type-Specific Epitope Locations Revealed by X-Ray Crystallographic Study of Adenovirus Type 5 Hexon, Molecular Therapy, vol.1, issue.1, pp.18-30, 2000.
DOI : 10.1006/mthe.1999.0001

J. J. Rux and R. M. Burnett, Adenovirus Structure, Human Gene Therapy, vol.15, issue.12, pp.1167-1176, 2004.
DOI : 10.1089/hum.2004.15.1167

J. J. Rux, P. R. Kuser, and R. M. Burnett, Structural and Phylogenetic Analysis of Adenovirus Hexons by Use of High-Resolution X-Ray Crystallographic, Molecular Modeling, and Sequence-Based Methods, Journal of Virology, vol.77, issue.17, pp.9553-9566, 2003.
DOI : 10.1128/JVI.77.17.9553-9566.2003

S. D. Saban, M. Silvestry, G. R. Nemerow, and P. L. Stewart, Visualization of ??-Helices in a 6-Angstrom Resolution Cryoelectron Microscopy Structure of Adenovirus Allows Refinement of Capsid Protein Assignments, Journal of Virology, vol.80, issue.24, pp.12049-12059, 2006.
DOI : 10.1128/JVI.01652-06

S. Martin, C. Burnett, and R. M. , Structural Studies on Adenoviruses, Curr Top Microbiol Immunol, vol.272, pp.57-94, 2003.
DOI : 10.1007/978-3-662-05597-7_3

K. L. Sargent, R. A. Meulenbroek, and R. J. Parks, Activation of Adenoviral Gene Expression by Protein IX Is Not Required for Efficient Virus Replication, Journal of Virology, vol.78, issue.10, pp.5032-5037, 2004.
DOI : 10.1128/JVI.78.10.5032-5037.2004

K. L. Sargent, P. Ng, C. Evelegh, F. L. Graham, and R. J. Parks, Development of a size-restricted pIX-deleted helper virus for amplification of helper-dependent adenovirus vectors, Gene Therapy, vol.11, issue.6, 2004.
DOI : 10.1038/sj.gt.3302107

G. Schoehn, M. Bakkouri, C. M. Fabry, O. Billet, L. F. Estrozi et al., 3D structure of canine adenovirus serotype 2 capsid, J Virol, 2008.

G. Schoehn, P. Fender, J. Chroboczek, and E. A. Hewat, Adenovirus 3 penton dodecahedron exhibits structural changes of the base on fibre binding, Embo J, vol.15, pp.6841-6846, 1996.

A. H. Schulick, G. Vassalli, P. F. Dunn, G. Dong, J. J. Rade et al., Established immunity precludes adenovirus-mediated gene transfer in rat carotid arteries. Potential for immunosuppression and vector engineering to overcome barriers of immunity., Journal of Clinical Investigation, vol.99, issue.2, pp.209-219, 1997.
DOI : 10.1172/JCI119149

A. Segerman, J. P. Atkinson, M. Marttila, V. Dennerquist, G. Wadell et al., Adenovirus Type 11 Uses CD46 as a Cellular Receptor, Journal of Virology, vol.77, issue.17, pp.9183-9191, 2003.
DOI : 10.1128/JVI.77.17.9183-9191.2003

E. Seiradake, C. , and S. , Crystal Structure of Enteric Adenovirus Serotype 41 Short Fiber Head, Journal of Virology, vol.79, issue.22, pp.14088-14094, 2005.
DOI : 10.1128/JVI.79.22.14088-14094.2005

E. Seiradake, H. Lortat-jacob, O. Billet, E. J. Kremer, C. et al., Structural and Mutational Analysis of Human Ad37 and Canine Adenovirus 2 Fiber Heads in Complex with the D1 Domain of Coxsackie and Adenovirus Receptor, Journal of Biological Chemistry, vol.281, issue.44, pp.33704-33716, 2006.
DOI : 10.1074/jbc.M605316200
URL : https://hal.archives-ouvertes.fr/hal-01062657

A. H. Shah and H. L. Lipton, Low-Neurovirulence Theiler's Viruses Use Sialic Acid Moieties on N-linked Oligosaccharide Structures for Attachment, Virology, vol.304, issue.2, pp.443-450, 2002.
DOI : 10.1006/viro.2002.1735

J. J. Short, C. Vasu, M. J. Holterman, D. T. Curiel, and A. Pereboev, Members of adenovirus species B utilize CD80 and CD86 as cellular attachment receptors, Virus Research, vol.122, issue.1-2, pp.144-153, 2006.
DOI : 10.1016/j.virusres.2006.07.009

D. Sirena, B. Lilienfeld, M. Eisenhut, S. Kalin, K. Boucke et al., The Human Membrane Cofactor CD46 Is a Receptor for Species B Adenovirus Serotype 3, Journal of Virology, vol.78, issue.9, pp.4454-4462, 2004.
DOI : 10.1128/JVI.78.9.4454-4462.2004

T. A. Smith, N. Idamakanti, M. L. Rollence, J. Marshall-neff, J. Kim et al., Gene Transfer in Mice, Human Gene Therapy, vol.14, issue.8, pp.777-787, 2003.
DOI : 10.1089/104303403765255165

G. Cochet, C. Puvion-dutilleul, and F. , Adenovirus infection targets the cellular protein kinase CK2 and RNA-activated protein kinase (PKR) into viral inclusions of the cell nucleus, Microsc Res Tech, vol.56, pp.465-478, 2002.

D. E. Staunton, V. J. Merluzzi, R. Rothlein, R. Barton, S. D. Marlin et al., A cell adhesion molecule, ICAM-1, is the major surface receptor for rhinoviruses, Cell, vol.56, issue.5, pp.849-853, 1989.
DOI : 10.1016/0092-8674(89)90689-2

S. C. Stevenson, M. Rollence, B. White, L. Weaver, and A. Mcclelland, Human adenovirus serotypes 3 and 5 bind to two different cellular receptors via the fiber head domain, J Virol, vol.69, pp.2850-2857, 1995.

P. L. Stewart, R. M. Burnett, M. Cyrklaff, and S. D. Fuller, Image reconstruction reveals the complex molecular organization of adenovirus, Cell, vol.67, issue.1, pp.145-154, 1991.
DOI : 10.1016/0092-8674(91)90578-M

P. L. Stewart, S. D. Fuller, and R. M. Burnett, Difference imaging of adenovirus: bridging the resolution gap between X-ray crystallography and electron microscopy, Embo J, vol.12, pp.2589-2599, 1993.

G. D. Stoner, B. Williams, A. Kniazeff, and M. B. Shimkin, Effect of Neuraminidase Pretreatment on the Susceptibility of Normal and Transformed Mammalian Cells to Bovine Enterovirus 261, Nature, vol.16, issue.5424, pp.319-320, 1973.
DOI : 10.1038/245319a0

S. Sutjipto, S. Ravindran, D. Cornell, Y. H. Liu, M. Horn et al., Characterization of Empty Capsids from a Conditionally Replicating Adenovirus for Gene Therapy, Human Gene Therapy, vol.16, issue.1, pp.109-125, 2005.
DOI : 10.1089/hum.2005.16.109

T. Suzuki, A. Portner, R. A. Scroggs, M. Uchikawa, N. Koyama et al., Receptor Specificities of Human Respiroviruses, Journal of Virology, vol.75, issue.10, pp.4604-4613, 2001.
DOI : 10.1128/JVI.75.10.4604-4613.2001

Y. Suzuki, T. Ito, T. Suzuki, R. E. Holland, . Jr et al., Sialic Acid Species as a Determinant of the Host Range of Influenza A Viruses, Journal of Virology, vol.74, issue.24, pp.11825-11831, 2000.
DOI : 10.1128/JVI.74.24.11825-11831.2000

M. J. Van-raaij, E. Chouin, H. Van-der-zandt, J. M. Bergelson, C. et al., Dimeric Structure of the Coxsackievirus and Adenovirus Receptor D1 Domain at 1.7 ?? Resolution, Structure, vol.8, issue.11, pp.1147-1155, 2000.
DOI : 10.1016/S0969-2126(00)00528-1

M. J. Van-raaij, N. Louis, J. Chroboczek, C. , and S. , Structure of the Human Adenovirus Serotype 2 Fiber Head Domain at 1.5 ?? Resolution, Virology, vol.262, issue.2, pp.333-343, 1999.
DOI : 10.1006/viro.1999.9849

M. J. Van-raaij, A. Mitraki, G. Lavigne, C. , and S. , A triple beta-spiral in the adenovirus fibre shaft reveals a new structural motif for a fibrous protein, Nature, vol.401, pp.935-938, 1999.

G. Vellekamp, F. W. Porter, S. Sutjipto, C. Cutler, L. Bondoc et al., Empty Capsids in Column-Purified Recombinant Adenovirus Preparations, Human Gene Therapy, vol.12, issue.15, pp.1923-1936, 2001.
DOI : 10.1089/104303401753153974

J. Vellinga, M. J. Rabelink, S. J. Cramer, D. J. Van-den-wollenberg, H. Van-der-meulen et al., Spacers Increase the Accessibility of Peptide Ligands Linked to the Carboxyl Terminus of Adenovirus Minor Capsid Protein IX, Journal of Virology, vol.78, issue.7, pp.3470-3479, 2004.
DOI : 10.1128/JVI.78.7.3470-3479.2004

J. Vellinga, T. G. Uil, J. De-vrij, M. J. Rabelink, L. Lindholm et al., A system for efficient generation of adenovirus protein IX-producing helper cell lines, The Journal of Gene Medicine, vol.74, issue.2, pp.147-154, 2006.
DOI : 10.1002/jgm.844

J. Vellinga, D. J. Van-den-wollenberg, S. Van-der-heijdt, M. J. Rabelink, and R. C. Hoeben, The Coiled-Coil Domain of the Adenovirus Type 5 Protein IX Is Dispensable for Capsid Incorporation and Thermostability, Journal of Virology, vol.79, issue.5, pp.3206-3210, 2005.
DOI : 10.1128/JVI.79.5.3206-3210.2005

R. R. Vives, H. Lortat-jacob, J. Chroboczek, and P. Fender, Heparan sulfate proteoglycan mediates the selective attachment and internalization of serotype 3 human adenovirus dodecahedron, Virology, vol.321, issue.2, pp.332-340, 2004.
DOI : 10.1016/j.virol.2004.01.015
URL : https://hal.archives-ouvertes.fr/hal-01061438

S. N. Waddington, J. H. Mcvey, D. Bhella, A. L. Parker, K. Barker et al., Adenovirus Serotype 5 Hexon Mediates Liver Gene Transfer, Cell, vol.132, issue.3, pp.397-409, 2008.
DOI : 10.1016/j.cell.2008.01.016

G. Wadell and E. Norrby, The soluble hemagglutinins of adenoviruses belonging to Rosen's subgroup III, Archiv f???r die gesamte Virusforschung, vol.21, issue.1-2, pp.53-62, 1969.
DOI : 10.1007/BF01241175

C. Y. Wang, J. C. Cusack, . Jr, R. Liu, A. S. Baldwin et al., Control of inducible chemoresistance: enhanced anti-tumor therapy through increased apoptosis by inhibition of NFkappaB, Nat Med, vol.5, pp.412-417, 1999.

H. Wang, Y. C. Liaw, D. Stone, O. Kalyuzhniy, I. Amiraslanov et al., Identification of CD46 Binding Sites within the Adenovirus Serotype 35 Fiber Knob, Journal of Virology, vol.81, issue.23, pp.12785-12792, 2007.
DOI : 10.1128/JVI.01732-07

K. Wang, T. Guan, D. A. Cheresh, and G. R. Nemerow, Regulation of Adenovirus Membrane Penetration by the Cytoplasmic Tail of Integrin beta 5, Journal of Virology, vol.74, issue.6, pp.2731-2739, 2000.
DOI : 10.1128/JVI.74.6.2731-2739.2000

A. Webster, R. T. Hay, and G. Kemp, The adenovirus protease is activated by a virus-coded disulphide-linked peptide, Cell, vol.72, issue.1, pp.97-104, 1993.
DOI : 10.1016/0092-8674(93)90053-S

T. J. Wickham, E. J. Filardo, D. A. Cheresh, and G. R. Nemerow, Integrin alpha v beta 5 selectively promotes adenovirus mediated cell membrane permeabilization, The Journal of Cell Biology, vol.127, issue.1, pp.257-264, 1994.
DOI : 10.1083/jcb.127.1.257
URL : https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2120185/pdf

T. J. Wickham, P. Mathias, D. A. Cheresh, and G. R. Nemerow, Integrins ??v??3 and ??v??5 promote adenovirus internalization but not virus attachment, Cell, vol.73, issue.2, pp.309-319, 1993.
DOI : 10.1016/0092-8674(93)90231-E

T. J. Wickham, P. W. Roelvink, D. E. Brough, and I. Kovesdi, Adenovirus targeted to heparan-containing receptors increases its gene delivery efficiency to multiple cell types, Nature Biotechnology, vol.70, issue.11, pp.1570-1573, 1996.
DOI : 10.1016/0042-6822(87)90150-4

T. J. Wickham, D. M. Segal, P. W. Roelvink, M. E. Carrion, A. Lizonova et al., Targeted adenovirus gene transfer to endothelial and smooth muscle cells by using bispecific antibodies, J Virol, vol.70, pp.6831-6838, 1996.

C. M. Wiethoff, H. Wodrich, L. Gerace, and G. R. Nemerow, Adenovirus Protein VI Mediates Membrane Disruption following Capsid Disassembly, Journal of Virology, vol.79, issue.4, 1992.
DOI : 10.1128/JVI.79.4.1992-2000.2005
URL : http://www.ncbi.nlm.nih.gov/pmc/articles/PMC546575

W. S. Wold and L. R. Gooding, Adenovirus region E3 proteins that prevent cytolysis by cytotoxic T cells and tumor necrosis factor, Mol Biol Med, vol.6, pp.433-452, 1989.

E. Wu, J. Fernandez, S. K. Fleck, V. Seggern, D. J. Huang et al., A 50-kDa Membrane Protein Mediates Sialic Acid-Independent Binding and Infection of Conjunctival Cells by Adenovirus Type 37, Virology, vol.279, issue.1, pp.78-89, 2001.
DOI : 10.1006/viro.2000.0703

E. Wu, L. Pache, V. Seggern, D. J. Mullen, T. M. Mikyas et al., Flexibility of the Adenovirus Fiber Is Required for Efficient Receptor Interaction, Journal of Virology, vol.77, issue.13, pp.7225-7235, 2003.
DOI : 10.1128/JVI.77.13.7225-7235.2003

E. Wu, S. A. Trauger, L. Pache, T. M. Mullen, D. J. Von-seggern et al., Membrane Cofactor Protein Is a Receptor for Adenoviruses Associated with Epidemic Keratoconjunctivitis, Journal of Virology, vol.78, issue.8, pp.3897-3905, 2004.
DOI : 10.1128/JVI.78.8.3897-3905.2004

H. Wu, T. Seki, I. Dmitriev, T. Uil, E. Kashentseva et al., Double Modification of Adenovirus Fiber with RGD and Polylysine Motifs Improves Coxsackievirus???Adenovirus Receptor-Independent Gene Transfer Efficiency, Human Gene Therapy, vol.13, issue.13, pp.1647-1653, 2002.
DOI : 10.1089/10430340260201734

D. Xia, L. J. Henry, R. D. Gerard, and J. Deisenhofer, Crystal structure of the receptor-binding domain of adenovirus type 5 fiberprotein at 1.7 ?? resolution, Structure, vol.2, issue.12, pp.1259-1270, 1994.
DOI : 10.1016/S0969-2126(94)00126-X

L. Xu, S. D. Benson, and R. M. Burnett, Nanoporous crystals of chicken embryo lethal orphan (CELO) adenovirus major coat protein, hexon, Journal of Structural Biology, vol.157, issue.2, pp.424-431, 2007.
DOI : 10.1016/j.jsb.2006.08.017

W. Zhang, A. , and R. , Interaction of the adenovirus major core protein precursor, pVII, with the viral DNA packaging machinery, Virology, vol.334, issue.2, pp.194-202, 2005.
DOI : 10.1016/j.virol.2005.01.048

H. Zhao, F. Granberg, L. Elfineh, U. Pettersson, and C. Svensson, Strategic Attack on Host Cell Gene Expression during Adenovirus Infection, Journal of Virology, vol.77, issue.20, pp.11006-11015, 2003.
DOI : 10.1128/JVI.77.20.11006-11015.2003

L. Zhou, Y. Luo, Y. Wu, J. Tsao, and M. Luo, Sialylation of the Host Receptor May Modulate Entry of Demyelinating Persistent Theiler's Virus, Journal of Virology, vol.74, issue.3, pp.1477-1485, 2000.
DOI : 10.1128/JVI.74.3.1477-1485.2000

C. Zubieta, L. Blanchoin, C. , and S. , Structural and biochemical characterization of a human adenovirus 2/12 penton base chimera, FEBS Journal, vol.55, issue.18, pp.4336-4345, 2006.
DOI : 10.1107/S0021889892009944
URL : https://hal.archives-ouvertes.fr/hal-00098651

C. Zubieta, G. Schoehn, J. Chroboczek, C. , and S. , The Structure of the Human Adenovirus 2 Penton, Molecular Cell, vol.17, issue.1, pp.121-135, 2005.
DOI : 10.1016/j.molcel.2004.11.041