S. P. Sinkins, C. F. Curtis, and S. L. , The potential application of inherited symbiont systems to pest control, pp.155-75, 1997.

. Hoffmann, Influential passengers: inherited microorganisms and arthropod reproduction

P. Smith, W. M. Leung-chiu, R. Montgomery, A. Orsborn, K. Kuznicki et al., The GLH Proteins, Caenorhabditis elegans P Granule Components, Associate with CSN-5 and KGB-1, Proteins Necessary for Fertility, and with ZYX-1, a Predicted Cytoskeletal Protein, Developmental Biology, vol.0, pp.333-380, 2002.
DOI : 10.1016/S0012-1606(02)90832-8

C. Souty, Contribution à l'étude de la synthèse des constituants du vitellus protéique et de son contrôle humoral chez deux crustacés isopodes Idothea basteri Audouin (Valvifère) et Porcellio dilatatus Brandt (Oniscoide) Thesis, 1984.

C. G. Steel and S. E. Campbell, Storage and translocation of calcium during the moulting cycle in the isopod crustacean Oniscus asellus, Am. Zool, vol.17, p.935, 1977.

M. Stein, R. Rappuoli, and A. Covacci, Tyrosine phosphorylation of the Helicobacter pylori CagA antigen after cag-driven host cell translocation, Proceedings of the National Academy of Sciences, vol.1, issue.6, pp.1263-1271, 2000.
DOI : 10.1038/14087

R. Stouthamer, R. F. Luck, and W. D. Hamilton, Antibiotics cause parthenogenetic Trichogramma (Hymenoptera/Trichogrammatidae) to revert to sex., Proceedings of the National Academy of Sciences, vol.87, issue.7, pp.2424-2431, 1990.
DOI : 10.1073/pnas.87.7.2424

URL : http://www.ncbi.nlm.nih.gov/pmc/articles/PMC53701

R. Stouthamer, The use of sexual versus asexual wasps in biological control, Entomophaga, vol.23, issue.1, pp.3-6, 1993.
DOI : 10.1007/BF02373133

R. Stouthamer, J. A. Breeuwert, R. F. Luck, and J. H. Werren, Molecular identification of microorganisms associated with parthenogenesis, Nature, vol.361, issue.6407, pp.66-74, 1993.
DOI : 10.1038/361066a0

R. Stouthamer and D. J. Kazmer, Cytogenetics of microbe-associated parthenogenesis and its consequences for gene flow in Trichogramma wasps, Heredity, vol.73, issue.3, pp.317-344, 1994.
DOI : 10.1038/hdy.1994.139

R. Stouthamer, Wolbachia-induced parthenogenesis, pp.102-126, 1997.

J. H. Hoffmann and . Werren, Influential passengers: inherited microorganisms and arthropod reproduction

L. V. Sun, A. Babaratsas, C. Savakis, S. L. Neill, and K. Bourtzis, Gene organization of the dnaA region of Wolbachia, J Bacteriol, vol.181, pp.4708-4718, 1999.

L. V. Sun, M. Riegler, and S. O. Neil, Development of a Physical and Genetic Map of the Virulent Wolbachia Strain wMelPop, Journal of Bacteriology, vol.185, issue.24, pp.7077-84, 2003.
DOI : 10.1128/JB.185.24.7077-7084.2003

. Tel-00011718, phénomènes de monogénie chez les Oniscoides, Bull. Biol. Fr. Bel, vol.75, pp.316-63, 2006.

Z. Veneti, M. E. Clark, S. Zabalou, T. L. Karr, C. Savakis et al., Cytoplasmic incompatibility and sperm cyst infection in different Drosophila-Wolbachia associations, Genetics, vol.164, pp.545-52, 2003.

J. P. Vogel, H. L. Andrews, S. K. Wong, and R. R. Isberg, Conjugative Transfer by the Virulence System of Legionella pneumophila, Science, vol.279, issue.5352, pp.873-879, 1998.
DOI : 10.1126/science.279.5352.873

C. Wandersman, Escherichia coli and Salmonella: cellular and molecular biology, p.p, 1996.

A. R. Weeks and J. A. Breeuwer, Wolbachia-induced parthenogenesis in a genus of phytophagous mites, Proceedings of the Royal Society B: Biological Sciences, vol.268, issue.1482, pp.2245-51, 2001.
DOI : 10.1098/rspb.2001.1797

A. R. Weeks, F. Marec, and J. A. Breeuwer, A Mite Species That Consists Entirely of Haploid Females, Science, vol.292, issue.5526, pp.2479-82, 2001.
DOI : 10.1126/science.1060411

A. A. Weiss, F. D. Johnson, and D. L. Burns, Molecular characterization of an operon required for pertussis toxin secretion., Proceedings of the National Academy of Sciences, vol.90, issue.7, pp.2970-2974, 1993.
DOI : 10.1073/pnas.90.7.2970

T. Wenseleers, F. Ito, S. Van-borm, R. Huybrechts, F. Volckaert et al., Widespread occurrence of the microorganism Wolbachia in ants, Proceedings of the Royal Society B: Biological Sciences, vol.265, issue.1404, pp.1447-52, 1998.
DOI : 10.1098/rspb.1998.0456

J. J. Wernegreen, H. Ochman, I. B. Jones, and N. A. Moran, Decoupling of Genome Size and Sequence Divergence in a Symbiotic Bacterium, Journal of Bacteriology, vol.182, issue.13, pp.3867-3876, 2000.
DOI : 10.1128/JB.182.13.3867-3869.2000

J. H. Werren, D. Windsor, and L. R. Guo, Distribution of Wolbachia among Neotropical Arthropods, Proceedings of the Royal Society B: Biological Sciences, vol.262, issue.1364, pp.197-204, 1995.
DOI : 10.1098/rspb.1995.0196

J. H. Werren, W. Zhang, and L. R. Guo, Evolution and Phylogeny of Wolbachia: Reproductive Parasites of Arthropods, Proceedings of the Royal Society B: Biological Sciences, vol.261, issue.1360, pp.55-63, 1995.
DOI : 10.1098/rspb.1995.0117

S. C. Winans, D. L. Burns, and P. J. Christie, Adaptation of a conjugal transfer system for the export of pathogenic macromolecules, Trends in Microbiology, vol.4, issue.2, pp.64-72, 1996.
DOI : 10.1016/0966-842X(96)81513-7

E. L. Wollman, F. Jacob, and W. Hayes, Conjugation and Genetic Recombination in Escherichia coli K-12, Cold Spring Harbor Symposia on Quantitative Biology, vol.21, issue.0, pp.141-162, 1956.
DOI : 10.1101/SQB.1956.021.01.012

J. D. Wright, The etiology and biology of cytoplasmic incompatibility in the Aedes scutellaris group, 1979.

J. H. Yen and A. R. Barr, New Hypothesis of the Cause of Cytoplasmic Incompatibility in Culex pipiens L., Nature, vol.8, issue.5313, pp.657-665, 1971.
DOI : 10.1038/232657a0

S. Zaffran, A. Chartier, P. Gallant, M. Astier, N. Arquier et al., A Drosophila RNA helicase gene, pitchoune, is required for cell growth and proliferation and is a potential target of d-Myc, Development, vol.125, pp.3571-84, 1998.

P. Zambryski, Basic Processes Underlying Agrobacterium-Mediated DNA Transfer to Plant Cells, Annual Review of Genetics, vol.22, issue.1, pp.1-30, 1988.
DOI : 10.1146/annurev.ge.22.120188.000245

E. Zchori-fein, R. T. Roush, and D. Rosen, Distribution of parthenogenesis-inducing symbionts in ovaries and eggs of Aphytis (Hymentoptera: Aphelinidae), Curr Microbiol, 1998.

W. Zhou, F. Rousset, and S. O. Neil, Phylogeny and PCR-based classification of Wolbachia strains using wsp gene sequences, Proceedings of the Royal Society B: Biological Sciences, vol.265, issue.1395, pp.509-524, 1998.
DOI : 10.1098/rspb.1998.0324

R. M. Alsmark, A. K. Podowski, A. S. Naslund, H. H. Eriksson, C. G. Winkler et al., The genome sequence of Rickettsia prowazekii and the origin of mitochondria, Nature, vol.396, pp.133-173, 1998.

C. Bandi, T. J. Anderson, C. Genchi, and M. L. Blaxter, Phylogeny of Wolbachia in filarial nematodes, Proceedings of the Royal Society B: Biological Sciences, vol.265, issue.1413, pp.2407-2420, 1998.
DOI : 10.1098/rspb.1998.0591

H. R. Braig, W. Zhou, S. L. Dobson, and S. L. , Cloning and characterization of a gene encoding the major surface protein of the bacterial endosymbiont Wolbachia pipientis, J Bacteriol, vol.180, pp.2373-2381, 1998.

P. J. Christie, Agrobacterium tumefaciens T-complex transport apparatus: a paradigm for a new family of multifunctional transporters in eubacteria., Journal of Bacteriology, vol.179, issue.10, pp.3085-94, 1997.
DOI : 10.1128/jb.179.10.3085-3094.1997

P. J. Christie, Type IV secretion: intercellular transfer of macromolecules by systems ancestrally related to conjugation machines, Molecular Microbiology, vol.181, issue.2, pp.294-305, 2001.
DOI : 10.1128/JB.182.14.3885-3895.2000

P. J. Christie and J. P. Vogel, Bacterial type IV secretion: conjugation systems adapted to deliver effector molecules to host cells, Trends in Microbiology, vol.8, issue.8, pp.354-60, 2000.
DOI : 10.1016/S0966-842X(00)01792-3

A. Covacci, J. L. Telford, G. Del-giudice, J. Parsonnet, and R. Rappuoli, Helicobacter pylori Virulence and Genetic Geography, Science, vol.284, issue.5418, pp.1328-1361, 1999.
DOI : 10.1126/science.284.5418.1328

Z. Ding, K. Atmakuri, and P. J. Christie, The outs and ins of bacterial type IV secretion substrates, Trends in Microbiology, vol.11, issue.11, pp.527-562, 2003.
DOI : 10.1016/j.tim.2003.09.004

S. L. Dobson, E. J. Marsland, Z. Veneti, K. Bourtzis, and S. L. , Characterization of Wolbachia Host Cell Range via the In Vitro Establishment of Infections, Applied and Environmental Microbiology, vol.68, issue.2, pp.656-60, 2002.
DOI : 10.1128/AEM.68.2.656-660.2002

A. P. Feinberg and B. Vogelstein, A technique for radiolabeling DNA restriction endonuclease fragments to high specific activity, Analytical Biochemistry, vol.132, issue.1, pp.6-13, 1983.
DOI : 10.1016/0003-2697(83)90418-9

A. A. Hoffmann and M. Turelli, Cytoplasmic incompatibilty in insects Influential passengers: inherited microorganisms and arthropod reproduction, pp.42-80, 1997.

G. D. Hurst, C. Bandi, L. Sacchi, A. G. Cochrane, D. Bertrand et al., Adonia variegata (Coleoptera: Coccinellidae) bears maternally inherited Flavobacteria that kill males only, Parasitology, vol.118, issue.2, pp.125-159, 1999.
DOI : 10.1017/S0031182098003655

F. M. Jiggins, G. D. Hurst, and M. E. Majerus, Sex ratio distortion in Acraea encedon (Lepidoptera: Nymphalidae) is caused by a male-killing bacterium, Heredity, vol.87, issue.1, pp.87-91, 1998.
DOI : 10.1046/j.1365-2540.1998.00357.x

P. Juchault, Contribution à l'étude de la différenciation sexuelle mâle chez les Crustacés Isopodes, 1966.

P. Juchault, M. Frelon, D. Bouchon, and T. Rigaud, New evidence for feminizing bacteria in terrestrial isopods: evolutionary implications, C. R. Acad. Sc. Paris, vol.317, pp.225-255, 1994.

S. Krause, M. Barcena, W. Pansegrau, R. Lurz, J. M. Carazo et al., Sequence-related protein export NTPases encoded by the conjugative transfer region of RP4 and by the cag pathogenicity island of Helicobacter pylori share similar hexameric ring structures, Proceedings of the National Academy of Sciences, vol.272, issue.48, pp.3067-72, 2000.
DOI : 10.1074/jbc.272.48.30228

J. J. Legrand, G. Martin, and J. C. Artaud, Corrélation entre la présence d'un symbiote bactérien dans les ovocytes de Porcellio dilatatus petiti, Arch. Inst. Pasteur Tunis, vol.55, pp.507-521, 1978.

M. Llosa, J. Zupan, C. Baron, and P. Zambryski, The N- and C-Terminal Portions of the Agrobacterium VirB1 Protein Independently Enhance Tumorigenesis, Journal of Bacteriology, vol.182, issue.12, pp.3437-3482, 2000.
DOI : 10.1128/JB.182.12.3437-3445.2000

T. Rigaud, Inherited microorganisms and sex determination of arthropods host Influential passengers: inherited microorganisms and arthropod reproduction, pp.81-101, 1997.

T. Rigaud, J. Moreau, and P. Juchault, Wolbachia infection in the terrestrial isopod Oniscus asellus: sex ratio distortion and effect on fecundity, Heredity, vol.83, issue.4, pp.469-75, 1999.
DOI : 10.1038/sj.hdy.6885990

S. Rivas, S. Bolland, E. Cabezon, F. M. Goni, F. De et al., TrwD, a Protein Encoded by the IncW Plasmid R388, Displays an ATP Hydrolase Activity Essential for Bacterial Conjugation, Journal of Biological Chemistry, vol.272, issue.41, pp.25583-90, 1997.
DOI : 10.1074/jbc.272.41.25583

E. Sagulenko, V. Sagulenko, J. Chen, and P. J. Christie, Role of Agrobacterium VirB11 ATPase in T-Pilus Assembly and Substrate Selection, Journal of Bacteriology, vol.183, issue.20, pp.5813-5838, 2001.
DOI : 10.1128/JB.183.20.5813-5825.2001

R. Stouthamer, Wolbachia-induced parthenogenesis, pp.102-126, 1997.

J. H. Hoffmann and . Werren, Influential passengers: inherited microorganisms and arthropod reproduction

S. Suzuki and K. Yamasaki, Sexual Bipotentiality of Developing Ovaries in the Terrestrial IsopodArmadillidium vulgare(Malacostraca, Crustacea), General and Comparative Endocrinology, vol.107, issue.1, pp.136-182, 1997.
DOI : 10.1006/gcen.1997.6914

D. V. Ward, O. Draper, J. R. Zupan, and P. C. Zambryski, Peptide linkage mapping of the Agrobacterium tumefaciens vir-encoded type IV secretion system reveals protein subassemblies, Proceedings of the National Academy of Sciences, vol.182, issue.13, pp.11493-500, 2002.
DOI : 10.1128/JB.182.13.3705-3716.2000

A. R. Weeks, F. Marec, and J. A. Breeuwer, A Mite Species That Consists Entirely of Haploid Females, Science, vol.292, issue.5526, pp.2479-82, 2001.
DOI : 10.1126/science.1060411

A. A. Weiss, F. D. Johnson, and D. L. Burns, Molecular characterization of an operon required for pertussis toxin secretion., Proceedings of the National Academy of Sciences, vol.90, issue.7, pp.2970-2974, 1993.
DOI : 10.1073/pnas.90.7.2970

S. C. Winans, D. L. Burns, and P. J. Christie, Adaptation of a conjugal transfer system for the export of pathogenic macromolecules, Trends in Microbiology, vol.4, issue.2, pp.64-72, 1996.
DOI : 10.1016/0966-842X(96)81513-7

T. , M. , U. , P. Prowazekii-), A. et al., TrBb (Rhizobium sp VirB11 (Wolbachia wVul)194 GPTGSGKTTMSKTLISAI---PPQERLITIEDTLELVI-P-HENHVRLLYAKNA--GGPD 12,VirB11 (B. henselae)187 GKTGSGKTTLSKALIAKI---PDDERIITIEDTPELVV-P-QPNYVSMIYSKDG--QGLA 13,TrwD (R388)Kbh (pCl1 C. limicula), I79275 AE001481221 NVTTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLK 8, VirB11 (Wolbachia wVul) VirB11 (pTi15955), PO7169222 AVTAEHLLQASLRMRPDRILLGEIRDDAAWAYLSEVVSGHPGSISTIHGANPVQGFKKLF 11,VirB11 (R. etli),247 AVTAEHLLQASLRMRPDRILLGEMRDDAAWAYLSEVVSGHPGSISTIHGANPVQGFKKLF 12,VirB11 (B. henselae), I79275 AF065404..255 AIDFDRLLTNALRQGPKRLIVGESRGKEALKMINFFQTGHPG-FTSVHARSAKEAVRRLM 1, TrbB (RP4), P54907 RP292 (R. prowazekii), VirB11 (Wolbachia wVul)...............279 LMVMQANLG--IPPDQIIPYIRNVIDTVIQLKRTCRGRRIVSEVLFTRFSNENA?~~~~~?? 9 X06826.............282 SLVKSSVQGASLEDRTLIDMLSTAIDVIIPFRAYEDVYEVGEIWLAADARRRGETIGDLL PO7169...............282 SLVKSSAQGASLEDRTLIDMLATAVDVIVPFRAHGDIYEVGEIWLAADARRRGETIGDLL 11,VirB11 (R. etli), AF176227............307 SLVKSSSQGAGLEDRTLIDMLSSAIDVIIPFRAYGDIYEVEEIWLAADARRRGEAIGDLL 12,VirB11 (B. henselae), AF182718........300 LLVKESEGGGDLERDDIRGLLISMIDIIIQCKRIEGKFKVTEIYYDPFKQRNIFGGN?~~?? 13,TrwD (R388), I79275 U77780HP0525 (H. pylori), pp.292-303, 2006.